CAZyme Information: CC1G_03016-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_03016-t26_1-p1
• CAZy Family: AA9
• CAZyme Description: SEC14 cytosolic factor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
689	AACS02000008|CGC2	78023.17	5.5976

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000008:1557936-1561666(+)

Full Sequence      

MTFDQQQILRNFREELVAEGILHEGDTIGSDQTTLLRFLRARRYNIQLAKTQFRECQEWR
QTVQGIGIDELYRRVDPFNYPERDVIFQSWPMWYHKTDKQGRPIHIQVVGEMGMRKLHKL
CPPQKHWEAVLVICESLPRELLPAASRAAGKSIEKAFVIVDLKGFGFEQFWQMKSILRGA
LQISQNYYPDTMGKLVVINAPASFSKIWPVLRRWLSDDTAEKVEILGDNFAEILLEYVDA
ENLPITRSASTSPSSADSTVEPSQTSPASPTPTNASGKFVVAHHMVGNTFPYTKDDWLED
IQLAHASGIDGFALNTGREVWEPERIADAYQAALELGHDFKLFLSLDMASLPCNSHEDAA
YLRRLVSQHASHPNQLMYNDKAFVSTFAGESCQFGHDNVVEGWKHQFTLHPELKERIYFV
PSFFMDPARFGEFKDVMDGTFNWNSGWPIQVTTSFAREQLDKLAEAAPSESSRVGRLPLL
ANPLQRAFVFLADQHLYAKRWESLVESRDKFDIVQILTWNDFGESHYIGPIKGAQPNSEA
WTDGMPHTAWLDLTSYYARAFKTGEYPKIEKDKIFMWSRPHSTEAESPDPVPKPDNFELM
EDAIWAVVMTTKPSTVVLSTSPTSRTFFQVPAGVSKLSVPITPGGTMRGTIERDGAVIVD
LHPSSEEFTFQGSPQSYNFNVFVASATAS

Enzyme Prediction     

EC	3.2.1.59:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH71	280	660	5.6e-93	0.992

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397634	Glyco_hydro_71	1.55e-147	280	660	1	372	Glycosyl hydrolase family 71. Family of alpha-1,3-glucanases.
211418	GH71	2.91e-81	274	564	1	283	Glycoside hydrolase family 71. This family of glycoside hydrolases 71 (following the CAZY nomenclature) function as alpha-1,3-glucanases (mutanases, EC 3.2.1.59). They appear to have an endo-hydrolytic mode of enzymatic activity and bacterial members are investigated as candidates for the development of dental caries treatments.The member from fission yeast, endo-alpha-1,3-glucanase Agn1p, plays a vital role in daughter cell separation, while Agn2p has been associated with endolysis of the ascus wall.
238099	SEC14	1.84e-26	84	245	2	152	Sec14p-like lipid-binding domain. Found in secretory proteins, such as S. cerevisiae phosphatidylinositol transfer protein (Sec14p), and in lipid regulated proteins such as RhoGAPs, RhoGEFs and neurofibromin (NF1). SEC14 domain of Dbl is known to associate with G protein beta/gamma subunits.
395525	CRAL_TRIO	6.58e-24	89	244	1	146	CRAL/TRIO domain.
214706	SEC14	3.33e-23	96	244	14	150	Domain in homologues of a S. cerevisiae phosphatidylinositol transfer protein (Sec14p). Domain in homologues of a S. cerevisiae phosphatidylinositol transfer protein (Sec14p) and in RhoGAPs, RhoGEFs and the RasGAP, neurofibromin (NF1). Lipid-binding domain. The SEC14 domain of Dbl is known to associate with G protein beta/gamma subunits.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW25381.1|GH71	6.35e-135	278	688	31	514
QRV98082.1|GH71	3.92e-132	271	686	28	521
VWP00414.1|GH71	1.01e-129	278	688	34	479
CCA70335.1|GH71	1.04e-119	278	683	53	473
CED85561.1|GH71	1.55e-101	276	680	350	756

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1AUA_A	4.40e-48	5	245	30	259	Phosphatidylinositol Transfer Protein Sec14p From Saccharomyces Cerevisiae [Saccharomyces cerevisiae]
6F0E_A	6.76e-48	5	245	41	270	Structure of yeast Sec14p with a picolinamide compound [Saccharomyces cerevisiae S288C]
6SLD_A	6.01e-39	1	245	22	261	Structure of the Phosphatidylcholine Binding Mutant of Yeast Sec14 Homolog Sfh1 (S175I,T177I) in Complex with Phosphatidylinositol [Saccharomyces cerevisiae S288C]
3B74_A	1.12e-38	1	245	35	274	Crystal Structure of Yeast Sec14 Homolog Sfh1 in Complex with Phosphatidylethanolamine [Saccharomyces cerevisiae],3B7N_A Crystal Structure of Yeast Sec14 Homolog Sfh1 in Complex with Phosphatidylinositol [Saccharomyces cerevisiae],3B7Q_A Crystal Structure of Yeast Sec14 Homolog Sfh1 in Complex with Phosphatidylcholine [Saccharomyces cerevisiae],3B7Q_B Crystal Structure of Yeast Sec14 Homolog Sfh1 in Complex with Phosphatidylcholine [Saccharomyces cerevisiae],3B7Z_A Crystal Structure of Yeast Sec14 Homolog Sfh1 in Complex with Phosphatidylcholine or Phosphatidylinositol [Saccharomyces cerevisiae]
3Q8G_A	2.88e-38	1	245	35	274	Resurrection of a functional phosphatidylinositol transfer protein from a pseudo-Sec14 scaffold by directed evolution [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O13716|AGN1_SCHPO	3.86e-69	273	682	18	418	Glucan endo-1,3-alpha-glucosidase agn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=agn1 PE=1 SV=2
sp|Q10137|SEC14_SCHPO	3.52e-49	5	244	28	256	Sec14 cytosolic factor OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sec14 PE=4 SV=1
sp|P24280|SEC14_YEAST	2.81e-47	5	245	33	262	SEC14 cytosolic factor OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC14 PE=1 SV=3
sp|B6GX22|MU71A_PENRW	1.63e-46	262	685	18	429	Mutanase Pc12g07500 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) OX=500485 GN=PCH_Pc12g07500 PE=1 SV=1
sp|P24859|SEC14_KLULA	3.26e-45	4	244	30	259	SEC14 cytosolic factor OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=SEC14 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000053	0.000000

TMHMM  Annotations     

There is no transmembrane helices in CC1G_03016-t26_1-p1.