CAZyme Information: CC1G_02538-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_02538-t26_1-p1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
354		39538.40	6.9748

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000009:1091369-1092592(-)

Full Sequence      

MSTVLQTSESWPGLEGVKRLFIFGDSYCSVFKTPTNFSQEISPSADNPFYTPYPGRTYAG
EGQPNWVGHFITKYAPGPRYDPSKKRQSKDYKKDPLLVYNYASGGDRVAGVAYQVQKLFL
PHVGAKPRWAPWDERNSLFTMFVGINDCASFFYPSGLQQSEGQPNVDPVAARVDQFMELQ
EELYAAGARNFVFFDLPPIDQSPALGLITAPTVYEVASSKDLDPNHISPYQKWNQILLGR
LETFKSSHPDATVFLFSTHQVFSDLLQNLEKYGFPTEDRHRKGGSVWVDHLHPTSRVHDI
IARSLAEFLNGVGGVGGRDAEESLESEKVKKERSGVSKFFRSASLKMGLGGKDS

Enzyme Prediction     

No EC number prediction in CC1G_02538-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	20	305	3e-33	0.9925093632958801

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	2.38e-36	19	308	1	270	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
238875	SGNH_plant_lipase_like	4.26e-15	100	279	79	263	SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
395531	Lipase_GDSL	1.65e-12	20	305	1	224	GDSL-like Lipase/Acylhydrolase.
225780	COG3240	3.49e-08	17	309	29	333	Phospholipase/lecithinase/hemolysin [Lipid transport and metabolism, General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRV83277.1|CE16	1.19e-50	7	314	20	277
QRV97477.1|CE16	1.28e-50	7	314	36	293
CCA70820.1|CE16	5.40e-48	11	312	43	339
QRW11544.1|CE16	1.41e-45	2	309	17	272
QRV82804.1|CE16	1.41e-45	2	309	17	272

PDB Hits     

CC1G_02538-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G2QJ27|AES1_MYCTT	3.13e-24	18	311	32	299	Acetylesterase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=aes1 PE=3 SV=1
sp|T2FKR1|AES1_THETO	3.13e-24	18	311	32	299	Acetylesterase OS=Thermothelomyces thermophilus OX=78579 GN=aes1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999871	0.000189

TMHMM  Annotations     

There is no transmembrane helices in CC1G_02538-t26_1-p1.