CAZyme Information: CC1G_01590-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_01590-t26_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
727		80824.06	7.7012

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000010:394221-396992(-)

Full Sequence      

MLRAVFILLFSFLFLPLVCVEARLERRHGQGREYHHRHARRSDLLASGGSGPAPTANVDS
DGNRTGNATLWPGDDTSQLVKRDGTKYVFMHHIVGNTYPYTPTDWEKDLLQIHAKGIDAI
ALNIGSSPWQLHQLHTAYTVASSLSSRLHLNPPLHLFLSFDFTEMECDVGFVVRYTNMFK
SYPVQFRVGGPGGRAMVSSYGGGCLGNEGWRRVKAETGAFVMPFVWGIEGQFKQWDSLDS
WYCWGCAWPQGNWDKSVSDDEYYFSQLGSRYATTVSMWMFTHLPSKNFYLRGDNWLINNR
WEQLVGMRDRLTFIEMLTWNDYGESDYFGPIRGAQPAGTYWADGFPHTAWFDMSEYYIKA
FKTGVYPAITKDVVYYWSRPHPARADATRPVLSKPSGWDWAEDFLWAAVFATHPATVTLR
LGSSSGTFQVPSGVSKLKIPTAPGRISVKMERGGVVLVDKTDGGFEFVERPARYNYNAYV
GAATATTTGPTPTTTTSSLPAPSSTTIDGVTWKYEGCYHDNSASRTLPDGLFISDSKGNT
REGCLRLCSRGGYRYGGVEYGMECFCSRGMREGVRRAEGEGECGVRCSGDASQMCGAAGR
INVFSRPSLTTPGFPPAATTTTTVNAPFPPASTTVSGKTWRYVGCYTDTTGARTLWDGGY
FVDGVGNSVRGCLERCGRLGWGYGGVEYGQVRGLALSFKFLLESRFDSMFFFLENPFDLM
VLPRESI

Enzyme Prediction     

EC	3.2.1.59:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH71	88	458	2.9e-85	0.9893333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397634	Glyco_hydro_71	1.74e-132	88	459	1	372	Glycosyl hydrolase family 71. Family of alpha-1,3-glucanases.
211418	GH71	1.49e-79	84	364	3	283	Glycoside hydrolase family 71. This family of glycoside hydrolases 71 (following the CAZY nomenclature) function as alpha-1,3-glucanases (mutanases, EC 3.2.1.59). They appear to have an endo-hydrolytic mode of enzymatic activity and bacterial members are investigated as candidates for the development of dental caries treatments.The member from fission yeast, endo-alpha-1,3-glucanase Agn1p, plays a vital role in daughter cell separation, while Agn2p has been associated with endolysis of the ascus wall.
396406	WSC	2.53e-17	516	597	2	80	WSC domain. This domain may be involved in carbohydrate binding.
214616	WSC	1.95e-13	511	606	1	94	present in yeast cell wall integrity and stress response component proteins. Domain present in WSC proteins, polycystin and fungal exoglucanase
211414	GH99_GH71_like	7.40e-11	93	358	1	283	Glycoside hydrolase families 71, 99, and related domains. This superfamily of glycoside hydrolases contains families GH71 and GH99 (following the CAZY nomenclature), as well as other members with undefined function and specificity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KGB77662.1|GH71	8.57e-81	85	484	443	847
ADV21435.1|GH71	8.57e-81	85	484	443	847
CCA70335.1|GH71	1.34e-80	86	481	53	474
AFR93842.1|GH71	1.31e-79	85	484	491	895
AUB23423.1|GH71	1.31e-79	85	484	491	895

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5FWW_B	1.53e-06	508	604	73	178	Wnt modulator Kremen in complex with DKK1 (CRD2) and LRP6 (PE3PE4) [Homo sapiens]
7BZT_E	2.19e-06	508	604	82	187	Chain E, KRM1 [Homo sapiens],7BZU_E Chain E, KRM1 [Homo sapiens]
6SNW_E	2.21e-06	508	604	85	190	Chain E, Kremen protein 1 [Homo sapiens]
5FWS_A	2.38e-06	508	604	113	218	Wnt modulator Kremen crystal form I at 1.90A [Homo sapiens],5FWT_A Wnt modulator Kremen crystal form I at 2.10A [Homo sapiens],5FWU_A Wnt modulator Kremen crystal form II at 2.8A [Homo sapiens],5FWV_A Wnt modulator Kremen crystal form III at 3.2A [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O13716|AGN1_SCHPO	1.09e-68	86	481	22	420	Glucan endo-1,3-alpha-glucosidase agn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=agn1 PE=1 SV=2
sp|B6GX22|MU71A_PENRW	1.53e-48	77	482	27	429	Mutanase Pc12g07500 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) OX=500485 GN=PCH_Pc12g07500 PE=1 SV=1
sp|O94510|AGN2_SCHPO	2.85e-26	86	439	11	380	Ascus wall endo-1,3-alpha-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=agn2 PE=1 SV=2
sp|D4AUF1|WSCD1_ARTBC	3.64e-22	499	690	185	357	WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07867 PE=1 SV=1
sp|D4AUF4|WSCD2_ARTBC	1.31e-13	512	688	525	672	WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07870 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000226	0.999756	CS pos: 22-23. Pr: 0.9706

TMHMM  Annotations     

There is no transmembrane helices in CC1G_01590-t26_1-p1.