CAZyme Information: CC1G_01557-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_01557-t26_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
371		42148.13	7.0588

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000010:280925-282407(-)

Full Sequence      

MRLFSIVVAALAVASPVLGAPQGGPILPAFKTIPSNDRNIFYHGRWDENNGSWWAGTGFK
VNIQNLRRLSINLGTNSSWPSAPTAISFDNGKFETVELASGTNHIAIPEHIAKAERGKTT
LLRVNVQGWQQNRIQFQSLDLNIDAQLEPYKPAKRAFQFIGDSLSAGQFLPQGVNQAWPF
LVGEHFKAEHRINAQPGATLTDRESYGNVHGISYQYFRTEDTGFIWTSDHNYTTPWDFKR
DVPRATHIVIHVGANDASHDISGEDFTKVYQEFLDKLRKINGPHAHIFIFTPWGWPNADG
NTYYYYEGVYEAIVKSRRAKGDRNIHLVDTTGWVTWDDVFHDNVHPNVPGMANIADKFIE
WLEKWEARNRW

Enzyme Prediction     

No EC number prediction in CC1G_01557-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE2	157	361	8.8e-25	0.9856459330143541

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238869	Endoglucanase_E_like	2.24e-14	159	363	4	169	Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
404371	Lipase_GDSL_2	3.19e-14	159	352	1	175	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	3.59e-10	159	360	3	186	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
238871	XynB_like	1.21e-08	248	358	44	153	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238865	sialate_O-acetylesterase_like1	2.90e-07	229	355	51	180	sialate O-acetylesterase_like family of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA73290.1|CE0	1.80e-123	18	365	1	346
QRV98465.1|CE0	2.77e-120	11	371	12	368
QRW13030.1|CE0	5.57e-120	33	371	29	368
QRV84417.1|CE0	3.28e-110	33	371	29	353
QRW17577.1|CE0	2.74e-105	10	371	7	358

PDB Hits     

CC1G_01557-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

CC1G_01557-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000261	0.999693	CS pos: 19-20. Pr: 0.9826

TMHMM  Annotations     

There is no transmembrane helices in CC1G_01557-t26_1-p1.