CAZyme Information: CC1G_01522-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_01522-t26_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
174		19399.03	5.9643

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000010:169866-170611(+)

Full Sequence      

MNLLAFLSTSLLLLPLHTLASQSAQVPIPGATQAENTYVSRIHPSAAVWKKCIDVRGGEL
ELRTPIQVYDCNGTPAQAWVYDGRTLHGTLLRVSGTPYCLDAGDPPFTNGKKVHLWECIH
GIPAQIWRYDYTGRWYLGDSGYCLDLTDGKLDNGNQLQIWECNDGPNQKWIIDL

Enzyme Prediction     

No EC number prediction in CC1G_01522-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM13	51	172	3.8e-22	0.6223404255319149

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395527	Ricin_B_lectin	1.90e-23	51	170	12	126	Ricin-type beta-trefoil lectin domain.
238092	RICIN	8.29e-22	51	172	11	124	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
214672	RICIN	7.89e-20	50	172	7	117	Ricin-type beta-trefoil. Carbohydrate-binding domain formed from presumed gene triplication.
411518	lectin_1	1.60e-18	41	170	710	834	lectin. Lectins are important adhesin proteins, which bind carbohydrate structures on host cell surface. The carbohydrate specificity of diverse lectins to a large extent dictates bacteria tissue tropism by mediating specific attachment to unique host sites expressing the corresponding carbohydrate receptor.
411519	lectin_2	1.27e-17	52	170	129	238	lectin. Lectins are important adhesin proteins, which bind carbohydrate structures on host cell surface. The carbohydrate specificity of diverse lectins to a large extent dictates bacteria tissue tropism by mediating specific attachment to unique host sites expressing the corresponding carbohydrate receptor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYG78258.1|CBM13	3.93e-11	43	125	341	418
AYG78727.1|CBM13	5.31e-11	44	125	350	426
QOV35461.1|CBM13	3.13e-06	51	126	381	498
QRX89501.1|CBM13	4.10e-06	51	109	198	252
QZL04637.1|CBM13	4.20e-06	51	109	211	265

PDB Hits     

CC1G_01522-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

CC1G_01522-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000278	0.999689	CS pos: 20-21. Pr: 0.9776

TMHMM  Annotations     

There is no transmembrane helices in CC1G_01522-t26_1-p1.