CAZyme Information: CC1G_01107-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_01107-t26_1-p1
• CAZy Family: AA2
• CAZyme Description: exocellobiohydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
454	AACS02000002|CGC7	49319.72	5.4986

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000002:962859-964557(+)

Full Sequence      

MLKGSKFFALSLALLPALVQAQRPLYAQCGGTGWTGETTCVSGAVCEVINQWYHQCLPGS
NQPQPPVTTQPPVVVPTTSQPPVVVPTNPPGGTPVPSTGNPFEGYDIYLSPYYAEEVEAA
AAMIDDPVLKAKALKVKEIPTFIWFDVVRKTPDLGRYLADATAIQQRTGRKQLVQIVVYD
LPDRDCAAAASNGEFSLADGGMEKYKDYVDRLASEIRKYPDVRIVAVIEPDSLANMVTNM
NVAKCRGAEAAYKEGVIYALRQLSALGVYSYVDAGHAGWLGWNANLAPSARLFAQIYKDA
GRSAFIRGLATNVSNYNALSATTRDPVTQGNDNYDELRFINALAPLLRNEGWDAKFIVDQ
GRSGVQNIRQEWGNWCNVYGAGFGMRPTLNTPSSAIDAIVWIKPGGEADGTSDTSAPRYD
THCGKSDSHKPAPEAGTWFQEYFVNLVKNANPPL

Enzyme Prediction     

EC	3.2.1.91:55	3.2.1.4:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH6	120	415	8.2e-93	0.95578231292517

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396075	Glyco_hydro_6	6.38e-166	126	418	1	293	Glycosyl hydrolases family 6.
227616	CelA1	4.79e-56	100	454	24	443	Cellulase/cellobiase CelA1 [Carbohydrate transport and metabolism].
197593	fCBD	2.04e-04	24	57	1	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAH08702.1|CBM1|GH6|3.2.1.91	0.0	1	454	1	454
CDJ79821.1|CBM1|GH6	7.52e-216	1	454	1	445
AAT64008.1|CBM1|GH6|3.2.1.91	1.05e-212	5	454	2	442
ADN88317.1|CBM1|GH6	9.97e-208	1	454	1	459
QDK64601.1|CBM1|GH6	9.65e-201	5	454	2	449

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VOG_A	2.74e-271	93	454	1	362	Chain A, Cellobiohydrolase [Coprinopsis cinerea],3VOH_A Chain A, Cellobiohydrolase [Coprinopsis cinerea],3VOI_A Chain A, Cellobiohydrolase [Coprinopsis cinerea]
3VOJ_A	4.54e-270	93	454	1	362	Chain A, Cellobiohydrolase [Coprinopsis cinerea]
5XCY_A	6.04e-178	97	454	1	358	Chain A, Glucanase [Phanerodontia chrysosporium],5XCZ_A Chain A, Glucanase [Phanerodontia chrysosporium]
4A05_A	4.72e-142	99	453	6	363	Chain A, Cellobiohydrolase Family 6 [Thermochaetoides thermophila]
4I5U_A	3.83e-141	99	452	1	355	Crystal structure of a fungal chimeric cellobiohydrolase Cel6A [Humicola insolens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P49075|GUX3_AGABI	4.69e-201	1	454	1	438	Exoglucanase 3 OS=Agaricus bisporus OX=5341 GN=cel3 PE=1 SV=1
sp|Q0CFP1|CBHC_ASPTN	3.28e-162	9	452	6	466	Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=cbhC PE=3 SV=1
sp|Q5B2E8|CBHC_EMENI	6.89e-161	10	452	8	453	1,4-beta-D-glucan cellobiohydrolase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cbhC PE=1 SV=2
sp|B0XWL3|CBHC_ASPFC	2.69e-160	9	452	7	452	Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=cbhC PE=3 SV=1
sp|Q4WFK4|CBHC_ASPFU	2.69e-160	9	452	7	452	Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=cbhC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000223	0.999740	CS pos: 21-22. Pr: 0.9799

TMHMM  Annotations     

There is no transmembrane helices in CC1G_01107-t26_1-p1.