CAZyme Information: CC1G_01039-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_01039-t26_1-p1
• CAZy Family: AA14
• CAZyme Description: GPI mannosyltransferase 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
469	AACS02000002|CGC17	52750.68	9.6212

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000002:787034-788605(-)

Full Sequence      

MSAFSTTSFPSFRKVLLFSAALRVALILYSEWHDARSLVKYTDVDYRVFTDAAWFLSNPG
PGAANRAEGPLKELFGVKLDFGNPYTRETYRYTPLLAWLLTPNGWLHPSFGKYIFAACDL
LNGWLIYKILLQYVLPKIVEQPKATSNIKPASNASSGTKAGKVNPYVLEKRQSLATIYSA
VHLLNPLVFSISTRGSSESILSLFVLATLYAAMKGRWNLAAMFLGLSTHWKIYPLVYGVG
TLGAIAAGSSGHARGLCAIVSNLVTRKTIQFTALSAVTFVLLGAGCYAIWGYPFLYESYI
YHLRRLDHRHNFSPYFYLTYLTYPSSDTSVVEEPVTLLSQLLHSPLTSFVPQMGLSLGLG
LLFGRTKEDLPFAWFLQTVAFVVFNKVCTSQYFLWYLLLLPLLLPRLSMSRWKAMGCIVV
WAAAQGLWLSEAYRLEFLGENVYFQLWIRGLIYVVGNCWVLVEIMKAYN

Enzyme Prediction     

EC	2.4.1.-:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	191	464	1.3e-88	0.9923664122137404

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178434	PLN02841	4.78e-96	11	469	7	419	GPI mannosyltransferase
252941	Mannosyl_trans	4.64e-68	191	465	1	259	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRV86716.1|GT50	9.24e-127	13	468	14	443
QRW15272.1|GT50	9.24e-127	13	468	14	443
QRW00769.1|GT50	5.25e-126	13	468	14	443
CDR44404.1|GT50	1.16e-110	19	469	10	406
CCA67020.1|GT50	9.52e-110	11	469	3	455

PDB Hits     

CC1G_01039-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7S4Z3|GPI14_NEUCR	3.53e-89	22	461	36	478	GPI mannosyltransferase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=gim-1 PE=3 SV=1
sp|Q66IJ4|PIGM_XENTR	2.99e-85	22	469	24	410	GPI mannosyltransferase 1 OS=Xenopus tropicalis OX=8364 GN=pigm PE=2 SV=1
sp|Q54IA4|PIGM_DICDI	1.15e-84	13	469	26	431	GPI mannosyltransferase 1 OS=Dictyostelium discoideum OX=44689 GN=pigm PE=3 SV=1
sp|Q500W7|PIGM_ARATH	3.16e-83	12	469	18	429	GPI mannosyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=PIGM PE=2 SV=1
sp|Q4I073|GPI14_GIBZE	6.20e-82	10	461	6	401	GPI mannosyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI14 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.977496	0.022531

TMHMM  Annotations     

Start	End
232	251
271	293
378	400
412	429
444	461