CAZyme Information: CC1G_00834-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_00834-t26_1-p1
• CAZy Family: AA12
• CAZyme Description: O-mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
780		89435.56	8.3559

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000007:1179146-1181973(+)

Full Sequence      

MASPSKGHTTPRLRQRPSSNPDTSSFEYQQVQDDEHVAEVYQNPRNRSEVERFFESSQGS
FIVVSALTALALALRFYKISFPDQVVFDEVHFGKFAAYYITHQYYFDVHPPLAKMLFGLA
GWFVGFDGSFLFDNIGDSYITNNVPYVGMRALPAVLGSLTVPIVYAIMKESGYSTIIAAF
SASLILFDNAHIAQSRLILLDAALIFFMSLTVYSYIRFRKYRYREFTFEWYTWLFMTGFW
MACTWASKVNGVLIVATIGIAVLIDLWDVLDSRKEGHTMEYFWNHFKARALGLIVWPITI
YLFFFYIHFSILYQSGPGDHFMSPAFQETLAGNEMLLNSKEIRYYDVVTIRHKDTKVFLH
SHPEKYPLQYEDGRISSQGQQVTGYGHNDTNNHWRIIPTKSLPETGRGRIVRNQDIVQLL
HVNTDTHLLTHDVASPLMPTNQEFTTWPRNDHSRHNDTLFQIQLSGDFNDSEPWKTKSGH
FRLIHVPTKVALWTRAKQLPEWAFKQQDVNGNKNANDKTAIWFVDDIIEDQFGEEPVDRG
SDAPVKVPKKMNFFRKFGELQLLMWQHNAGLTASHPYASGPINWPFLISGISFWTNNDDK
KQIYLIGNIVGWWTCVIGLSIYVGILGADLLARRRQMDPIPDPVRNRLWNNTGFFLLVWA
VHYLPFFLMSRQLFIHHYLPSHLASALIAGSVLSFVLSETVNYPISIVGPKTRLRPSQYA
DTGLKGFAIVILFALLLFLLFVFLAPLTYGTPGLTGEQVNAKRLLSSWTLHFAAKKTHDV

Enzyme Prediction     

EC	2.4.1.109:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	67	309	1.8e-69	0.9910313901345291

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224839	PMT1	0.0	75	772	38	697	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
396786	PMT	2.16e-77	75	313	11	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
406576	PMT_4TMC	8.15e-64	555	707	1	154	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
397103	MIR	4.57e-16	354	524	7	185	MIR domain. The MIR (protein mannosyltransferase, IP3R and RyR) domain is a domain that may have a ligand transferase function.
197746	MIR	2.57e-10	342	398	4	56	Domain in ryanodine and inositol trisphosphate receptors and protein O-mannosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VWO96990.1|GT39	0.0	31	777	26	769
QRW02771.1|GT39	0.0	54	775	57	775
QRV73816.1|GT39	0.0	54	775	57	775
QRW16888.1|GT39	0.0	54	775	57	775
QRV88619.1|GT39	0.0	54	758	57	758

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P25_A	5.66e-94	62	768	51	727	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_A Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
6P25_B	6.66e-89	13	681	23	681	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_B Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
6P28_A	1.67e-13	359	525	25	191	Crystal structure of the MIR domain (aa 337-532) of the S. cerevisiae mannosyltransferase Pmt2 [Saccharomyces cerevisiae]
6ZQP_A	2.37e-13	359	525	42	208	Structure of the Pmt2-MIR domain with bound ligands [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59X23|PMT4_CANAL	4.30e-205	64	765	51	747	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMT4 PE=2 SV=2
sp|O42933|PMT4_SCHPO	5.75e-203	67	772	65	774	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ogm4 PE=3 SV=1
sp|P46971|PMT4_YEAST	5.59e-199	64	759	56	748	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT4 PE=1 SV=1
sp|F1QF89|POMT1_DANRE	3.25e-116	62	770	16	715	Protein O-mannosyl-transferase 1 OS=Danio rerio OX=7955 GN=pomt1 PE=1 SV=1
sp|Q8R2R1|POMT1_MOUSE	5.97e-105	66	770	43	742	Protein O-mannosyl-transferase 1 OS=Mus musculus OX=10090 GN=Pomt1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999798	0.000224

TMHMM  Annotations     

Start	End
104	126
146	168
173	192
197	216
229	246
251	270
290	312
610	632
653	675
685	707
727	749