CAZyme Information: CC1G_00471-t26_1-p1

Basic Information

• Species: Coprinopsis cinerea
• Lineage: Basidiomycota; Agaricomycetes; ; Psathyrellaceae; Coprinopsis; Coprinopsis cinerea
• CAZyme ID: CC1G_00471-t26_1-p1
• CAZy Family: AA1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
505	AACS02000005|CGC3	57001.29	5.4682

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ccinereaokay7-130	13657	240176	301	13356

• Gene Location: location=AACS02000005:1983605-1986052(+)

Full Sequence      

MQLGLKKLLVASVLVASTEAQCPGYAAYARTPHPPFSSGPLALPYMRPEPACRTFNSTAV
EKVIQDMNGLLKDPDLARLFENTFPNTLDTTVRYYSEEHNLAFIITGDITAQWLRDTANQ
FAHYHSLLRVDPALAKLVKAVINNEARYVAQFPYCGAFQPPSESGLPTSHNEWADNVIVN
PPVDPDIVFECKYEIDSLCGFLKLSRAYYQETKDDSFINDHWKHAVDQIFRVIREQSQPS
FDEDFNFISYYNWTGSRGALSPRVNNRGNNEPKAYTGLVGTSHRPSDDLTVFAFLTPANA
MLSVELKELGDVLDELGIMQNVSALAKEWSTRIRDAIWETTVVDNIFAYETNGFGGRYVM
DDANVPSLLSLPYLGFLEKDDPTYLSTRKLLLSKRNPYYAQGRNFSGIGSLRLTKMYVNR
PMSQVSAIFGTDDDSEIMHSLYLIANNTNGLGLIHESQSIYNASDYTRSWFAWANSYFAE
MILDLADRKPHLILKENKSYKPGRT

Enzyme Prediction     

No EC number prediction in CC1G_00471-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH125	73	483	3e-128	0.9975124378109452

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399660	Glyco_hydro_125	0.0	73	483	1	416	Metal-independent alpha-mannosidase (GH125). This family, which contains bacterial and fungal glycoside hydrolases, is also known as GH125. They function as metal-independent alpha-mannosidases, with specificity for alpha-1,6-linked non-reducing terminal mannose residues. Structurally this family is part of the 6 hairpin glycosidase superfamily.
226068	COG3538	7.28e-137	51	497	1	434	Meiotically up-regulated gene 157 (Mug157) protein (function unknown) [Function unknown].
225922	SGA1	0.003	298	387	418	503	Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VWO96882.1|GH125	1.39e-242	1	504	1	499
QRW05648.1|GH125	5.99e-239	1	503	1	496
UKZ89651.1|GH125	2.32e-228	18	504	38	524
QRV76748.1|GH125	3.69e-228	1	503	1	496
QYT03629.1|GH125	1.26e-225	18	504	38	524

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2P0V_A	2.42e-75	47	487	43	470	Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482],2P0V_B Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482]
3P2C_A	9.46e-75	47	487	21	452	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483],3P2C_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483]
3ON6_A	9.65e-74	47	487	23	450	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483],3ON6_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483]
6RQK_A	1.79e-69	60	484	12	421	Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13],6RQK_B Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13]
5M7I_A	9.72e-69	60	484	12	421	Crystal structure of GH125 1,6-alpha-mannosidase mutant from Clostridium perfringens in complex with 1,6-alpha-mannobiose [Clostridium perfringens str. 13],5M7Y_A Crystal structure of GH125 1,6-alpha-mannosidase mutant from Clostridium perfringens in complex with 1,6-alpha-mannotriose [Clostridium perfringens str. 13]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10449|MU157_SCHPO	3.27e-136	22	499	27	509	Meiotically up-regulated gene 157 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug157 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000256	0.999713	CS pos: 20-21. Pr: 0.9765

TMHMM  Annotations     

There is no transmembrane helices in CC1G_00471-t26_1-p1.