CAZyme Information: CAX44632.1

Basic Information

• Species: Candida dubliniensis
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida dubliniensis
• CAZyme ID: CAX44632.1
• CAZy Family: GT71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
481	FM992688|CGC9	56706.31	8.0324

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CdubliniensisCD36	6095	573826	235	5860

• Gene Location: location=FM992688:864384-865829(-)

Full Sequence      

MISIISLRKRKLVSILAIFTIFIISSSIIGYYNGHHHIIKIVENYTPEDFSNSITSLTNK
FDFSYLPGFKGISNSNNNKTSNDSLDDLDINGFTLIPGNVKFKFLNKGNKKGTPEQILHQ
NMKDYKELLGSNPIGQPKDAILVPPPPPEELPSYKRANATILSLVRNNELQSIGISIKRL
QKKFNSKYNYPYTFLNDEPFTDRFKQRILKFTGNAPVEFIQIKPEYWEKPSFIDTVKESK
EMEIMFKHDVAYAKKQSYHNMCRFYSSQFYKIPELAKYKYYWRVEPHVNFFTDINYDVFK
YMETTGKIYGFTINLYDNEESVKTLWPETIKYLNQGDNYKYINPKGSFQWLLEDLQNPKK
TKFAGGYSTCHFWSNFEIGDFDFFRNEAYDNWVKYLDSTGKFYYERWGDAPVHSIGVSLF
ADKDKIHFFKDIGYDHDPYTNCPNTETTQMCEIAKFSRWEHLYDQNCLMNWLHHDQPKDV
Y

Enzyme Prediction     

EC	2.4.1.131:20	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT15	156	437	2.3e-107	0.9926739926739927

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396385	Glyco_transf_15	4.25e-146	110	438	1	313	Glycolipid 2-alpha-mannosyltransferase. This is a family of alpha-1,2 mannosyl-transferases involved in N-linked and O-linked glycosylation of proteins. Some of the enzymes in this family have been shown to be involved in O- and N-linked glycan modifications in the Golgi.
227353	KTR1	3.40e-117	153	474	77	389	Mannosyltransferase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAX44632.1|GT15	0.0	1	481	1	481
CAB87243.1|GT15	0.0	1	481	1	480
AOW26075.1|GT15	0.0	1	481	1	480
AAV05163.1|GT15	0.0	35	481	3	448
CCE40689.1|GT15	6.25e-218	53	481	40	465

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5A07_A	1.22e-119	114	479	65	429	X-ray structure of the mannosyltransferase Ktr4p from S. cerevisiae in complex with GDP [Saccharomyces cerevisiae S288C],5A07_B X-ray structure of the mannosyltransferase Ktr4p from S. cerevisiae in complex with GDP [Saccharomyces cerevisiae S288C],5A08_A X-ray structure of the mannosyltransferase Ktr4p from S. cerevisiae [Saccharomyces cerevisiae S288C],5A08_B X-ray structure of the mannosyltransferase Ktr4p from S. cerevisiae [Saccharomyces cerevisiae S288C]
7BOO_A	5.17e-106	156	456	66	363	Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_B Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_C Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_D Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_E Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_F Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOP_A Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_B Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_C Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_D Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_E Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_F Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163]
1S4N_A	7.62e-76	156	443	26	301	Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p [Saccharomyces cerevisiae],1S4N_B Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p [Saccharomyces cerevisiae],1S4O_A Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p: binary complex with GDP/Mn [Saccharomyces cerevisiae],1S4O_B Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p: binary complex with GDP/Mn [Saccharomyces cerevisiae],1S4P_A Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p: ternary complex with GDP/Mn and methyl-alpha-mannoside acceptor [Saccharomyces cerevisiae],1S4P_B Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p: ternary complex with GDP/Mn and methyl-alpha-mannoside acceptor [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P38131|KTR4_YEAST	1.63e-118	114	479	95	459	Probable mannosyltransferase KTR4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KTR4 PE=1 SV=1
sp|O60160|OMH1_SCHPO	2.34e-79	149	449	63	351	O-glycoside alpha-1,2-mannosyltransferase omh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=omh1 PE=3 SV=1
sp|P87207|MNT3_CANAL	7.15e-78	153	473	68	377	Probable mannosyltransferase MNT3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNT3 PE=3 SV=2
sp|Q00310|MNT1_CANAL	4.56e-77	145	443	93	384	Glycolipid 2-alpha-mannosyltransferase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNT1 PE=3 SV=1
sp|P46592|MNT2_CANAL	4.03e-76	155	443	138	415	Glycolipid 2-alpha-mannosyltransferase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNT2 PE=3 SV=4

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.993843	0.006191

TMHMM  Annotations     

Start	End
12	34