CAZyme Information: CAX43552.1

Basic Information

• Species: Candida dubliniensis
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida dubliniensis
• CAZyme ID: CAX43552.1
• CAZy Family: GT34
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
584	FM992689|CGC16	64472.94	6.7126

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CdubliniensisCD36	6095	573826	235	5860

• Gene Location: location=FM992689:603323-605077(-)

Full Sequence      

MFFRLSKNCGRFSKRFVRYNSSISRNSSKSSLLAYTFVAIGFSGAGYLIGKSLVKKSSPT
SADRSTSPLSTLSSPQYANEKDFQAGLSKIVDIVGQENASFDKDVLLAQNDSFYSTHHPP
NPDVQKPSAVIYPTSTEQVSEIMKVAHQYRIPIVANSGLTSLEGQNIHTRGPYSISLSFQ
NMNQIVAFHPDDLDIVVQPGVGWQELDDFLVNDPKGKNLKFGPDPGIGANIGGMVGTSAS
GTNAFKYGTMKENVVNLTVVLADGTIIKTRQRPRKSSAGYHLTRLFIGSEGTLGIVTEIT
VKLHVRPKYEFITVAAFPSIKDAASAAETIIAQGIQPNAMEILNETMMSFVNDTSDSDKK
NLETPTLFFKLGGPTLESTEEQANLVDEIAKKNNVMKLQRSTNDEENAELWAARRNGLWS
TYQYGTKVLEDKNDVQVWTTDVAVPISKLSLVISEINDYLIEKGFKDRFSVMGHIGDGNC
HFIILYNSPDYDKVHHVVDHMVERALSHDGTCTGEHGVGVGKRKYLPSELGVEAVDTMRQ
IKLALDPRRILNPDKIFKIDPEENLDEQLDKGSVKEKPSCMHNH

Enzyme Prediction     

No EC number prediction in CAX43552.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA4	74	318	4.3e-22	0.46551724137931033

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178402	PLN02805	9.20e-124	96	556	107	548	D-lactate dehydrogenase [cytochrome]
223354	GlcD	3.95e-109	90	557	2	456	FAD/FMN-containing dehydrogenase [Energy production and conversion].
397178	FAD-oxidase_C	6.54e-60	306	556	1	248	FAD linked oxidases, C-terminal domain. This domain has a ferredoxin-like fold.
183043	PRK11230	1.83e-43	127	555	56	470	glycolate oxidase subunit GlcD; Provisional
396238	FAD_binding_4	2.45e-40	127	270	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSZ31245.1|GT31	3.48e-81	127	513	548	905
QGA13141.1|AA4	3.45e-16	75	342	36	307
CDP22417.1|AA4	2.21e-14	68	308	29	270
VBB71413.1|AA4	4.16e-14	68	308	29	270
BCS27721.1|AA4	1.20e-12	75	344	36	309

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6LPN_A	7.63e-36	130	555	57	469	Chain A, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens],6LPN_B Chain B, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens],6LPP_A Chain A, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens],6LPP_B Chain B, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens],6LPQ_A Chain A, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens],6LPQ_B Chain B, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens],6LPT_A Chain A, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens],6LPT_B Chain B, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens],6LPU_A Chain A, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens],6LPU_B Chain B, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens],6LPX_A Chain A, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens],6LPX_B Chain B, D-2-hydroxyglutarate dehydrogenase, mitochondrial [Homo sapiens]
3PM9_A	8.45e-35	87	556	18	475	Chain A, Putative oxidoreductase [Rhodopseudomonas palustris],3PM9_B Chain B, Putative oxidoreductase [Rhodopseudomonas palustris],3PM9_C Chain C, Putative oxidoreductase [Rhodopseudomonas palustris],3PM9_D Chain D, Putative oxidoreductase [Rhodopseudomonas palustris],3PM9_E Chain E, Putative oxidoreductase [Rhodopseudomonas palustris],3PM9_F Chain F, Putative oxidoreductase [Rhodopseudomonas palustris]
2UUU_A	4.60e-23	127	557	138	584	alkyldihydroxyacetonephosphate synthase in P212121 [Dictyostelium discoideum],2UUU_B alkyldihydroxyacetonephosphate synthase in P212121 [Dictyostelium discoideum],2UUU_C alkyldihydroxyacetonephosphate synthase in P212121 [Dictyostelium discoideum],2UUU_D alkyldihydroxyacetonephosphate synthase in P212121 [Dictyostelium discoideum],2UUV_A alkyldihydroxyacetonephosphate synthase in P1 [Dictyostelium discoideum],2UUV_B alkyldihydroxyacetonephosphate synthase in P1 [Dictyostelium discoideum],2UUV_C alkyldihydroxyacetonephosphate synthase in P1 [Dictyostelium discoideum],2UUV_D alkyldihydroxyacetonephosphate synthase in P1 [Dictyostelium discoideum]
4BCA_A	3.85e-20	127	350	206	428	MAMMALIAN ALKYLDIHYDROXYACETONEPHOSPHATE SYNTHASE: Tyr578Phe mutant [Cavia porcellus],4BCA_B MAMMALIAN ALKYLDIHYDROXYACETONEPHOSPHATE SYNTHASE: Tyr578Phe mutant [Cavia porcellus],4BCA_C MAMMALIAN ALKYLDIHYDROXYACETONEPHOSPHATE SYNTHASE: Tyr578Phe mutant [Cavia porcellus],4BCA_D MAMMALIAN ALKYLDIHYDROXYACETONEPHOSPHATE SYNTHASE: Tyr578Phe mutant [Cavia porcellus]
4BBY_A	3.85e-20	127	350	206	428	Mammalian Alkyldihydroxyacetonephosphate Synthase: Wild-Type [Cavia porcellus],4BBY_B Mammalian Alkyldihydroxyacetonephosphate Synthase: Wild-Type [Cavia porcellus],4BBY_C Mammalian Alkyldihydroxyacetonephosphate Synthase: Wild-Type [Cavia porcellus],4BBY_D Mammalian Alkyldihydroxyacetonephosphate Synthase: Wild-Type [Cavia porcellus],4BC9_A MAMMALIAN ALKYLDIHYDROXYACETONEPHOSPHATE SYNTHASE: WILD-TYPE, ADDUCT WITH CYANOETHYL [Cavia porcellus],4BC9_B MAMMALIAN ALKYLDIHYDROXYACETONEPHOSPHATE SYNTHASE: WILD-TYPE, ADDUCT WITH CYANOETHYL [Cavia porcellus],4BC9_C MAMMALIAN ALKYLDIHYDROXYACETONEPHOSPHATE SYNTHASE: WILD-TYPE, ADDUCT WITH CYANOETHYL [Cavia porcellus],4BC9_D MAMMALIAN ALKYLDIHYDROXYACETONEPHOSPHATE SYNTHASE: WILD-TYPE, ADDUCT WITH CYANOETHYL [Cavia porcellus],5ADZ_A Ether Lipid-Generating Enzyme AGPS in complex with inhibitor 1a [Cavia porcellus],5ADZ_B Ether Lipid-Generating Enzyme AGPS in complex with inhibitor 1a [Cavia porcellus],5ADZ_C Ether Lipid-Generating Enzyme AGPS in complex with inhibitor 1a [Cavia porcellus],5ADZ_D Ether Lipid-Generating Enzyme AGPS in complex with inhibitor 1a [Cavia porcellus],5AE1_A Ether Lipid-Generating Enzyme AGPS in complex with inhibitor ZINC69435460 [Cavia porcellus],5AE1_B Ether Lipid-Generating Enzyme AGPS in complex with inhibitor ZINC69435460 [Cavia porcellus],5AE1_C Ether Lipid-Generating Enzyme AGPS in complex with inhibitor ZINC69435460 [Cavia porcellus],5AE1_D Ether Lipid-Generating Enzyme AGPS in complex with inhibitor ZINC69435460 [Cavia porcellus],5AE2_A Ether Lipid-Generating Enzyme AGPS in complex with inhibitor 1e [Cavia porcellus],5AE2_B Ether Lipid-Generating Enzyme AGPS in complex with inhibitor 1e [Cavia porcellus],5AE2_C Ether Lipid-Generating Enzyme AGPS in complex with inhibitor 1e [Cavia porcellus],5AE2_D Ether Lipid-Generating Enzyme AGPS in complex with inhibitor 1e [Cavia porcellus],5AE3_A Ether Lipid-Generating Enzyme AGPS in complex with antimycin A [Cavia porcellus],5AE3_B Ether Lipid-Generating Enzyme AGPS in complex with antimycin A [Cavia porcellus],5AE3_C Ether Lipid-Generating Enzyme AGPS in complex with antimycin A [Cavia porcellus],5AE3_D Ether Lipid-Generating Enzyme AGPS in complex with antimycin A [Cavia porcellus],6GOU_A Development of Alkyl Glycerone Phosphate Synthase Inhibitors: Complex with Inhibitor 2I [Cavia porcellus],6GOU_B Development of Alkyl Glycerone Phosphate Synthase Inhibitors: Complex with Inhibitor 2I [Cavia porcellus],6GOU_C Development of Alkyl Glycerone Phosphate Synthase Inhibitors: Complex with Inhibitor 2I [Cavia porcellus],6GOU_D Development of Alkyl Glycerone Phosphate Synthase Inhibitors: Complex with Inhibitor 2I [Cavia porcellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12627|DLD1_KLULA	1.06e-153	26	564	47	574	D-lactate dehydrogenase [cytochrome], mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=DLD1 PE=3 SV=2
sp|P32891|DLD1_YEAST	1.77e-146	28	563	39	581	D-lactate dehydrogenase [cytochrome] 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DLD1 PE=1 SV=2
sp|Q94AX4|DLD_ARATH	1.24e-102	124	557	143	561	D-lactate dehydrogenase [cytochrome], mitochondrial OS=Arabidopsis thaliana OX=3702 GN=DLD PE=1 SV=1
sp|F1QXM5|LDHD_DANRE	5.42e-94	127	559	70	490	Probable D-lactate dehydrogenase, mitochondrial OS=Danio rerio OX=7955 GN=ldhd PE=2 SV=1
sp|Q7TNG8|LDHD_MOUSE	2.53e-82	125	557	64	484	Probable D-lactate dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Ldhd PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000021	0.000008

TMHMM  Annotations     

There is no transmembrane helices in CAX43552.1.