CAZyme Information: CAX41529.1

Basic Information

• Species: Candida dubliniensis
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida dubliniensis
• CAZyme ID: CAX41529.1
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
291		32886.76	6.7526

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CdubliniensisCD36	6095	573826	235	5860

• Gene Location: location=FM992692:370448-371323(+)

Full Sequence      

MIRSYIKNIILAILSPLLITTPPLVLPPPYEKIIQEIITVFSVDNYDDGSLAPIILRLAW
HCCATYDVTTNTGGSNGATMRFVPEITDEGNYGLDVARAALEPIKQRYPTISYADLWTLA
GKVAIEHMGGPTIIWKSGRVDYTNDQDVPPNGLLPFADKNANHVRKTFTRLGFNDRETVA
LIGAHGVGRCHKRFSGWEGKWTSIPKTFSNQFYVVLLNEIWSQGEVPETGKTQYFNADKS
LIMLNTDMELIRDKSYLRWVEIYAKDEPRFLHDFSAAFAKLLELGIKREPF

Enzyme Prediction     

No EC number prediction in CAX41529.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA2	42	285	2.1e-60	0.9411764705882353

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173825	ascorbate_peroxidase	3.00e-127	30	289	13	253	Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water.
178218	PLN02608	3.27e-68	50	287	29	245	L-ascorbate peroxidase
178467	PLN02879	2.49e-62	52	285	34	246	L-ascorbate peroxidase
173823	plant_peroxidase_like	4.61e-62	46	283	12	255	Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase.
223453	KatG	5.02e-57	47	286	90	417	Catalase (peroxidase I) [Inorganic ion transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNP98603.1|AA2	7.74e-99	30	290	6	265
QGI94677.1|AA2	4.02e-97	27	289	16	282
QGI63795.1|AA2	4.02e-97	27	289	16	282
QGI81067.1|AA2	4.02e-97	27	289	16	282
BDA47129.1|AA2	1.45e-95	15	286	76	346

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4GED_A	1.26e-76	51	287	25	260	Crystal Structure of the Leishmania Major Peroxidase-Cytochrome C Complex [Leishmania major]
5AL9_A	1.34e-76	51	287	25	260	Structure of Leishmania major peroxidase D211R mutant (high res) [Leishmania major],5ALA_A Structure of Leishmania major peroxidase D211R mutant (low res) [Leishmania major],5ALA_B Structure of Leishmania major peroxidase D211R mutant (low res) [Leishmania major]
5AMM_A	1.34e-76	51	287	25	260	Structure of Leishmania major peroxidase D211N mutant [Leishmania major],5AMM_B Structure of Leishmania major peroxidase D211N mutant [Leishmania major]
3RIV_A	1.39e-76	51	287	26	261	The Crystal Structure of Leishmania major Peroxidase [Leishmania major strain Friedlin],3RIV_B The Crystal Structure of Leishmania major Peroxidase [Leishmania major strain Friedlin]
3RIW_A	4.49e-75	51	287	26	261	The Crystal Structure of Leishmania major Peroxidase mutant C197T [Leishmania major strain Friedlin],3RIW_B The Crystal Structure of Leishmania major Peroxidase mutant C197T [Leishmania major strain Friedlin]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59X94|CCPR2_CANAL	1.66e-193	1	289	1	289	Putative heme-binding peroxidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CCP2 PE=3 SV=2
sp|Q6BIB1|CCPR2_DEBHA	1.83e-133	31	289	158	416	Putative heme-binding peroxidase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=DEHA2G12166g PE=3 SV=3
sp|Q6CAB5|CCPR2_YARLI	1.38e-99	30	290	6	265	Putative cytochrome c peroxidase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=YALI0D04268g PE=3 SV=1
sp|Q4HWQ2|CCPR2_GIBZE	1.23e-93	27	288	16	281	Putative heme-binding peroxidase OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=FGRRES_10606 PE=3 SV=1
sp|A4R606|CCPR2_MAGO7	4.21e-92	27	289	5	271	Putative heme-binding peroxidase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=MGG_10368 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.534918	0.465070

TMHMM  Annotations     

There is no transmembrane helices in CAX41529.1.