CAZyme Information: CAX41430.1

Basic Information

• Species: Candida dubliniensis
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida dubliniensis
• CAZyme ID: CAX41430.1
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
599	FM992692|CGC5	69443.99	5.3392

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CdubliniensisCD36	6095	573826	235	5860

• Gene Location: location=FM992692:105450-107249(-)

Full Sequence      

MSDSSNLSGLISSSSTSNDITPVVNEESESTISGLQQQQNFKIKSHSRYFSPQSNITTKK
FNYLDNPFYYMDKDFDSNHHHHHQQENRDHEGFRNGHSHTNSTSSDGNNNINKKRKRIGK
WNWRFKRIDLKKSFRFIIAIVSILVIFVLAIIFAIMSSFIINNPIRNGHKIEKLTNINYA
QLKSIRTNLIDPDTPIEFYNLNKTNHQEGDWTLVFSDEFELDGRTFHEGDDQFFTAVELY
YAATHDLEYYLPQMITTNNSNLEILFDKFNYSGLNYVSGMLQTWNKLCFNKHVKIEIKAK
LPYEIKNGLWPAIWSLGNLARPGFLATTDGIWPYTYNECDFGILPNQSTLNEEMSYLPGQ
RLSKCVCTGEDHPNHGIGRGAPEIDIIEGLFQYDKFWGVQTLQVAPFDEWWRPDYDYVDI
INDNITIIREDIGTVYQESISLGTLIDNEFPFQKFTMEYKSDSQNNINSYLKFSIDDITT
SVINGSALHPNEFIGWREITKEPMSIILNMGLSYMWNPRVNIDELKLPAKFLIDYIRIYQ
PNNIIEMTCDPIDYPTDDYIQSHSIAYENPNLTSWFQAGFEFPKNSLSHQCKVPPPIVT

Enzyme Prediction     

No EC number prediction in CAX41430.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	217	539	2.8e-122	0.9969325153374233

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397841	SKN1	0.0	136	591	46	500	Beta-glucan synthesis-associated protein (SKN1). This family consists of the beta-glucan synthesis-associated proteins KRE6 and SKN1. Beta1,6-Glucan is a key component of the yeast cell wall, interconnecting cell wall proteins, beta1,3-glucan, and chitin. It has been postulated that the synthesis of beta1,6-glucan begins in the endoplasmic reticulum with the formation of protein-bound primer structures and that these primer structures are extended in the Golgi complex by two putative glucosyltransferases that are functionally redundant, Kre6 and Skn1. This is followed by maturation steps at the cell surface and by coupling to other cell wall macromolecules.
185689	GH16_fungal_KRE6_glucanase	2.95e-145	213	540	1	295	Saccharomyces cerevisiae KRE6 and related glucanses, member of glycosyl hydrolase family 16. KRE6 is a Saccharomyces cerevisiae glucanase that participates in the synthesis of beta-1,6-glucan, a major structural component of the cell wall. It is a golgi membrane protein required for normal beta-1,6-glucan levels in the cell wall. KRE6 is closely realted to laminarinase, a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
225182	BglS	1.20e-45	174	551	14	353	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].
185693	GH16_laminarinase_like	4.54e-17	215	539	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAX41430.1|GH16_2	0.0	1	599	1	599
AOW29491.1|GH16_2	0.0	2	594	3	612
CCE41415.1|GH16_2	7.95e-213	56	594	14	522
ABN68143.2|GH16_2	6.67e-167	172	594	40	480
CCG24204.1|GH16_2	4.72e-153	135	444	75	378

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CRQ_A	2.92e-11	210	540	2	231	Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S [Zobellia galactanivorans],4CRQ_B Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S [Zobellia galactanivorans],4CTE_A Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S in complex with a thio-oligosaccharide [Zobellia galactanivorans],4CTE_B Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S in complex with a thio-oligosaccharide [Zobellia galactanivorans]
6JH5_A	3.16e-08	211	544	4	236	Structure of Marine bacterial laminarinase [Aquimarina]
6JHJ_A	1.38e-07	211	544	4	236	Structure of Marine bacterial laminarinase mutant-E135A [Aquimarina],6JIA_A Marine bacterial laminarinase mutant E135A complex with laminaritetraose [Aquimarina sp.],6M6P_A Structure of Marine bacterial laminarinase mutant E135A in complex with 1,3-beta-cellotriosyl-glucose [Aquimarina sp.]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32486|KRE6_YEAST	2.72e-139	167	591	284	711	Beta-glucan synthesis-associated protein KRE6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KRE6 PE=1 SV=2
sp|P87024|SKN1_CANAX	1.37e-137	131	587	276	734	Beta-glucan synthesis-associated protein SKN1 OS=Candida albicans OX=5476 GN=SKN1 PE=2 SV=1
sp|P87023|KRE6_CANAX	1.43e-134	172	587	314	737	Beta-glucan synthesis-associated protein KRE6 OS=Candida albicans OX=5476 GN=KRE6 PE=2 SV=1
sp|P33336|SKN1_YEAST	2.86e-132	172	591	341	763	Beta-glucan synthesis-associated protein SKN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SKN1 PE=1 SV=1
sp|O13941|YEPB_SCHPO	6.51e-122	172	591	201	627	Uncharacterized beta-glucan synthesis-associated protein C23H3.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC23H3.11c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000041	0.000003

TMHMM  Annotations     

Start	End
134	156