CAZyme Information: CAX41206.1

Basic Information

• Species: Candida dubliniensis
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida dubliniensis
• CAZyme ID: CAX41206.1
• CAZy Family: GH17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
437	FM992693|CGC3	50377.81	6.7817

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CdubliniensisCD36	6095	573826	235	5860

• Gene Location: location=FM992693:593060-594373(+)

Full Sequence      

MLSAELKRRKKLLLPLALISGIIGLIFFTNYNYSFTTTSHPVLSSSSITPHKSNSAFPKL
DQSSSAKAKPNPGNLIVNHQNDKSKTDTYFTKFTHKDPQFDYTKITYTSTNKNFITNNIK
VDEETGETTEVVNKPTVLIMSVIGNNEPYGSDRYFDQFMLTVLSLVENQPDYEFSLGLLN
NNNEEFIRIQDYFEKNLQKDLPETLSSIFKSISLISAPFLDQNTGFSREQRHDDRVQRLR
RRLIAKSRNFLLLNSLNLEQYVLSLDADMVRFEHPEKFIKTFIDSKKDIVVPRIERPGLK
DYDKNSWRGQRTKPTKEQLDKMDNNQWDQWNYVPHDVKDHIYHFQTYLDNKDNEYDLHKD
EYDYIVPLDSVGGAVLFAKSIVFKQGVVFPTSLIVGTTWDRQEGYDGIETEGVCYLAKPL
GFSCWGMPNVVAHHSGG

Enzyme Prediction     

No EC number prediction in CAX41206.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT62	117	391	1.3e-70	0.9701492537313433

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397491	Anp1	2.00e-63	125	391	11	263	Anp1. The members of this family (Anp1, Van1 and Mnn9) are membrane proteins required for proper Golgi function. These proteins co-localize within the cis Golgi, and that they are physically associated in two distinct complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAX41206.1|GT62	0.0	1	437	1	437
AOW30225.1|GT62	2.39e-265	1	437	1	432
ABN65744.2|GT62	4.05e-126	83	435	42	386
CCE39652.1|GT62	4.30e-118	75	434	95	452
CCG25325.1|GT62	5.90e-118	75	434	95	451

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZF8_A	1.41e-07	229	434	108	299	Crystal structure of Saccharomyces cerevisiae Mnn9 in complex with GDP and Mn. [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P23642|VAN1_YEAST	1.43e-08	203	434	298	511	Mannan polymerase I complex VAN1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VAN1 PE=1 SV=3
sp|P53697|MNN9_CANAL	5.44e-08	209	434	155	365	Mannan polymerase complex subunit MNN9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN9 PE=3 SV=1
sp|Q00314|VAN1_CANAX	6.67e-08	209	434	211	418	Vanadate resistance protein OS=Candida albicans OX=5476 GN=VAN1 PE=3 SV=1
sp|P39107|MNN9_YEAST	2.46e-07	229	434	198	389	Mannan polymerase complexes subunit MNN9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN9 PE=1 SV=3
sp|O74745|ANP1_SCHPO	4.71e-07	231	434	185	371	Mannan polymerase II complex anp1 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=anp1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999859	0.000150

TMHMM  Annotations     

Start	End
12	34