CAZyme Information: CAWG_05589-T-p1

Basic Information

• Species: Candida albicans
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida albicans
• CAZyme ID: CAWG_05589-T-p1
• CAZy Family: GT71
• CAZyme Description: Has domain(s) with predicted catalytic activity

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
617	Supercontig_1.8_C_albicans_WO-1|CGC4	70408.31	7.0609

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CalbicansWO1	6160	294748	0	6160

• Gene Location: location=Supercontig_1.8_C_albicans_WO-1:532326-534179(+)

Full Sequence      

MMTQSRISNLAKPILAFLFILTLYSILFRKSDDGADKILEPHGYAVDNEEDPLFLKQQFM
QHGLSNNNNNKKAGGKDANTNKLQPDKAIVIDKTFLDQMDKKTHKCPDYVVYSQKRHPPF
SIGRFKYPYMRPAPKCRTFVSTAVESVIEDLKSKIEDPDLARLLENCLPNTLDTTILWHQ
PKIKTARQDALLPQSFIVTGDIHAEWLRDAARQLSVYQPMVRFDPKLKELILGAINTQAY
YIINSPYCNAFHPPPGSGVKRGDTAFDQVHPKPDWKQVFECKYELDSLASFLTLTNEYYE
NSKGDTSFINSSWLKAFEKVLIILHRESVPSFDQETGQMLPFYYSFQRNTNIGSETLPLG
GVGNPVNYGTGLIRSAFRPSDDATILQFFIPANIHMLTELKRARNTYLTNENIARDTMLV
ETADTFINALSTGIEKYGIVNHPIYGKVYAYEVDGYGSATFMDDANIPSLLSIPDLGYTK
IDDEIYQNTRKMILSKQGNPYYLKGHFFEGIGGPHIGIRNAWPMSLLMRIRTTDDDDEII
SSLEMIMRTTANLGLMHESVNVNSRQGRDYTRSWFAWCNSEFGKTILHLAKNKPHLIFKK
EWQNVPYDIESVLSQFI

Enzyme Prediction     

No EC number prediction in CAWG_05589-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH125	157	587	1e-161	0.9975124378109452

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399660	Glyco_hydro_125	0.0	157	587	1	416	Metal-independent alpha-mannosidase (GH125). This family, which contains bacterial and fungal glycoside hydrolases, is also known as GH125. They function as metal-independent alpha-mannosidases, with specificity for alpha-1,6-linked non-reducing terminal mannose residues. Structurally this family is part of the 6 hairpin glycosidase superfamily.
226068	COG3538	2.02e-158	136	596	2	429	Meiotically up-regulated gene 157 (Mug157) protein (function unknown) [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOW30603.1|GH125	0.0	1	617	1	617
CAX40772.1|GH125	0.0	1	617	1	610
CCE41065.1|GH125	2.03e-308	1	615	1	611
CCG25178.1|GH125	1.77e-306	1	615	40	647
CAG89684.1|GH125	9.42e-294	91	617	79	605

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2P0V_A	3.73e-99	127	590	39	469	Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482],2P0V_B Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482]
3ON6_A	1.79e-98	127	590	19	449	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483],3ON6_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483]
3P2C_A	4.50e-96	131	590	21	451	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483],3P2C_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483]
6RQK_A	1.40e-88	144	593	12	426	Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13],6RQK_B Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13]
3QT3_A	2.19e-88	144	593	12	426	Analysis of a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Clostridium perfringens CPE0426 apo-structure [Clostridium perfringens],3QT9_A Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Clostridium perfringens CPE0426 complexed with alpha-1,6-linked 1-thio-alpha-mannobiose [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10449|MU157_SCHPO	1.67e-176	95	599	16	506	Meiotically up-regulated gene 157 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug157 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.950690	0.049331

TMHMM  Annotations     

Start	End
7	29