CAZyme Information: CAWG_05277-T-p1

Basic Information

• Species: Candida albicans
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida albicans
• CAZyme ID: CAWG_05277-T-p1
• CAZy Family: GT71
• CAZyme Description: Ortholog(s) have glucan endo-1,3-beta-D-glucosidase activity and cell surface, extracellular region localization

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
416	Supercontig_1.7_C_albicans_WO-1|CGC7	43548.64	4.4595

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CalbicansWO1	6160	294748	0	6160

• Gene Location: location=Supercontig_1.7_C_albicans_WO-1:879106-880356(-)

Full Sequence      

MRFSQATVLAFAALSLAAPAFEADNKNIKREDCDKTSFHGHHKHKRAVAYDYAYVTVTVD
GNGNPITTVSPVLSIETIAKSEETSSTSTSISSTTTIVQNDSLTSDEPKTLSLPSGTIKP
SSFATESQSQSQSSSTGGSGSTNGIEGDLAAFEDPTEEFEDGVLSCSDFPSGQGVIPLDH
LGFGGWSGIENSDGSTGGNCKEGSYCSYACQSGMSKTQWPEDQPSNGVSIGGLLCKNGKL
YKSSTRSNYLCEWGVKKANVVNKLSETVAICRTDYPGTENMVIPTVVGGGSTSVITVVDQ
STYYTWRGGATSAQYYVNNAGVSWEDGCVWGTPGSGVGNWAPLNFGAGYANGIAYLSLIP
NPNNRDSLNFKVKIVGESGSTVSGSCSYANGKFNGNSDDGCTVGVTSGEADFVLYN

Enzyme Prediction     

No EC number prediction in CAWG_05277-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH132	124	415	8.6e-128	0.9537953795379538

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397780	SUN	7.16e-146	161	402	1	244	Beta-glucosidase (SUN family). Members of this family include Nca3, Sun4 and Sim1. This is a family of yeast proteins, involved in a diverse set of functions (DNA replication, aging, mitochondrial biogenesis and cell septation). BGLA from Candida wickerhamii has been characterized as a Beta-glucosidase EC:3.2.1.21.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOW30028.1|GH132	7.05e-249	1	416	1	418
CAX41028.1|GH132	1.15e-215	1	416	1	420
CCG24630.1|GH132	1.38e-171	1	416	1	420
CCE39890.1|GH132	1.91e-169	1	416	1	431
ABN67031.2|GH132	2.12e-168	142	416	116	390

PDB Hits     

CAWG_05277-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59NP5|SUN41_CANAL	1.25e-249	1	416	1	418	Secreted beta-glucosidase SUN41 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SUN41 PE=1 SV=2
sp|P40472|SIM1_YEAST	3.26e-136	145	416	205	476	Probable secreted beta-glucosidase SIM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SIM1 PE=1 SV=2
sp|P53616|SUN4_YEAST	1.36e-134	142	416	146	420	Probable secreted beta-glucosidase SUN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUN4 PE=1 SV=1
sp|Q5AKU5|UTH1_CANAL	1.29e-120	143	415	101	372	Secreted beta-glucosidase SIM1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SIM1 PE=1 SV=1
sp|B3LRC2|UTH1_YEAS1	1.06e-119	158	415	105	362	Probable secreted beta-glucosidase UTH1 OS=Saccharomyces cerevisiae (strain RM11-1a) OX=285006 GN=UTH1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000303	0.999679	CS pos: 22-23. Pr: 0.6553

TMHMM  Annotations     

There is no transmembrane helices in CAWG_05277-T-p1.