CAZyme Information: CAWG_05225-T-p1

Basic Information

• Species: Candida albicans
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida albicans
• CAZyme ID: CAWG_05225-T-p1
• CAZy Family: GT66
• CAZyme Description: Protein of unknown function

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
395	Supercontig_1.7_C_albicans_WO-1|CGC1	45887.88	8.7740

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CalbicansWO1	6160	294748	0	6160

• Gene Location: location=Supercontig_1.7_C_albicans_WO-1:766032-767219(-)

Full Sequence      

MTKYTTTASRRTGFRRHIPIILIIIILGLLVTFFFGFSSFKGAKDIQEVISNLPNDKILG
LSNILSTENSKNQGELLIKIEKLHNKYYKDQEERLKKIEKQNNEILQEIKLLKSPPQHAS
IREKLTFVYPYDADVRFPAYIWQTWKHGLNDEKFDEKYREGERQWAYKNPGFVHELFNDD
TAHTMIKYLYRQIPEVINAFEALPEVILRMDFFRYLILFAKGGVYADIDTFPIQPIPNWI
PENVSPLDIGLIVGVESDSNSPNWRSESVRRLQLGQFVLQSKPGHPILREIIAQIVLYTK
KLEVPELNGNPNAKAIAIMKWTGSGRFTDVVFQYLNDYILSSIYESINWQHLHNLEVPKL
LGDVLVLPRVSFSADDEKNPLSFVKHYGDKIYKQV

Enzyme Prediction     

No EC number prediction in CAWG_05225-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	159	242	7.7e-21	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.29e-37	88	388	39	342	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.81e-17	165	246	11	93	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOW30080.1|GT32	4.74e-284	1	395	1	395
CAX41078.1|GT32	9.27e-268	1	395	1	394
CCE39846.1|GT32	4.30e-170	1	393	23	429
CCG24586.1|GT32	1.04e-167	29	393	27	406
ABN66691.2|GT32	6.88e-167	38	393	31	400

PDB Hits     

CAWG_05225-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P47124|HOC1_YEAST	2.27e-100	7	395	4	390	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|Q5A4E3|OCH1_CANAL	5.27e-68	114	386	76	369	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P31755|OCH1_YEAST	2.13e-49	107	394	66	471	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q9UTR6|OCH1_SCHPO	3.76e-49	122	387	129	388	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.943384	0.056631

TMHMM  Annotations     

Start	End
13	35