CAZyme Information: CAWG_04846-T-p1

Basic Information

• Species: Candida albicans
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida albicans
• CAZyme ID: CAWG_04846-T-p1
• CAZy Family: GT4
• CAZyme Description: Ortholog(s) have role in fungal-type cell wall organization

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
505	Supercontig_1.6_C_albicans_WO-1|CGC4	57278.89	4.8604

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CalbicansWO1	6160	294748	0	6160

• Gene Location: location=Supercontig_1.6_C_albicans_WO-1:1049432-1050949(+)

Full Sequence      

MYKQILTFLILFLRYILSEFPDDPYEDDDTSDDNNSDYEGQKCNPYRDKACLVNDEALGK
KIFESFAEGTKYFTITSSTRGVRFGSEGLALTIQDEFDNPALVSSFYIMYGKVEAEIKGA
AGKGIISSFYLQSDDLDEIDVVEIFGSDPYEFQTNFFIKGNTTTYDRGRYHEMHPSPLSE
FHKYGIEWSPDLITWYLDDKPVRMLGRRNKHGLPCSPMFLKFSLWSVEDDDEGTIAWAGG
AASFSEGPFTMHIKNLKVQDYSKALTYSYGNLRDGNWLDLRADGGYLYEGHKYCLPPKML
DKLKPTPKQETDDDQVFTSSKSQRVATKISKDKNTVSYYPHSATNSHTTWDRLSEWETEQ
DETGTDDTENSDNEEEEESITAIPISKSRKGSTRRLDISTQLPPLSQNESKIAEIKNITT
TKHIHNTTTSLQISKIESKKVRVTTTIYSSSTPQSTSKSRMPYNIFFNYPGKENSRFKSG
VSSILATSFSSVVIAEILVIVVLLL

Enzyme Prediction     

EC	2.4.1.-:3	3.2.1.39:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	87	240	2.3e-56	0.9873417721518988

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185692	GH16_fungal_CRH1_transglycosylase	4.15e-97	71	262	10	203	glycosylphosphatidylinositol-glucanosyltransferase. Group of fungal GH16 members related to Saccharomyces cerevisiae Crh1p. Chr1p and Crh2p are transglycosylases that are required for the linkage of chitin to beta(1-3)glucose branches of beta(1-6)glucan, an important step in the assembly of new cell wall. Both have been shown to be glycosylphosphatidylinositol (GPI)-anchored. A third homologous protein, Crr1p, functions in the formation of the spore wall. They belongs to the family 16 of glycosyl hydrolases that includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
395585	Glyco_hydro_16	3.96e-44	82	239	6	168	Glycosyl hydrolases family 16.
185683	Glyco_hydrolase_16	6.24e-25	63	253	3	204	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185684	GH16_lichenase	1.97e-22	73	257	25	209	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.
185685	GH16_XET	4.22e-21	73	258	10	200	Xyloglucan endotransglycosylase, member of glycosyl hydrolase family 16. Xyloglucan endotransglycosylases (XETs) cleave and religate xyloglucan polymers in plant cell walls via a transglycosylation mechanism. Xyloglucan is a soluble hemicellulose with a backbone of beta-1,4-linked glucose units, partially substituted with alpha-1,6-linked xylopyranose branches. It binds noncovalently to cellulose, cross-linking the adjacent cellulose microfibrils, giving it a key structural role as a matrix polymer. Therefore, XET plays an important role in all plant processes that require cell wall remodeling.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOW29885.1|GH16_18	0.0	1	505	1	504
AAV02850.1|GH16_18	0.0	1	505	23	526
CAX41820.1|GH16_18	1.61e-277	1	505	1	521
CCG24345.1|GH16_18	1.54e-108	42	313	59	329
CCE40070.1|GH16_18	3.68e-107	42	285	60	304

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IBU_A	5.05e-48	42	283	3	245	Apo Crh5 transglycosylase [Aspergillus fumigatus Af293],6IBU_B Apo Crh5 transglycosylase [Aspergillus fumigatus Af293],6IBW_A Crh5 transglycosylase in complex with NAG [Aspergillus fumigatus Af293],6IBW_B Crh5 transglycosylase in complex with NAG [Aspergillus fumigatus Af293]
5SV8_A	4.24e-15	67	258	11	201	Crystal Structure of the catalytic nucleophile and surface cysteine mutant of VvEG16 in complex with a xyloglucan oligosaccharide [Vitis vinifera]
3H0O_A	5.56e-15	96	262	3	169	Chain A, Beta-glucanase [Fibrobacter succinogenes]
1ZM1_A	7.65e-15	96	262	3	169	Crystal structures of complex F. succinogenes 1,3-1,4-beta-D-glucanase and beta-1,3-1,4-cellotriose [Fibrobacter succinogenes],1ZM1_B Crystal structures of complex F. succinogenes 1,3-1,4-beta-D-glucanase and beta-1,3-1,4-cellotriose [Fibrobacter succinogenes]
1MVE_A	7.91e-15	96	262	6	172	Crystal structure of a natural circularly-permutated jellyroll protein: 1,3-1,4-beta-D-glucanase from Fibrobacter succinogenes [Fibrobacter succinogenes]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AK54|CRH12_CANAL	0.0	1	505	1	504	Extracellular glycosidase CRH12 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CRH12 PE=1 SV=1
sp|P53301|CRH1_YEAST	3.14e-72	43	288	40	283	Probable glycosidase CRH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CRH1 PE=1 SV=1
sp|Q5AFA2|CRH11_CANAL	9.15e-71	43	285	24	265	Extracellular glycosidase CRH11 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CRH11 PE=1 SV=1
sp|D4ALQ5|CRH11_ARTBC	1.96e-51	42	306	22	282	Probable extracellular glycosidase ARB_05253 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_05253 PE=1 SV=2
sp|Q8J0P4|CRF1_ASPFU	1.67e-46	42	284	24	267	Probable glycosidase crf1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=crf1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000256	0.999714	CS pos: 18-19. Pr: 0.9788

TMHMM  Annotations     

Start	End
482	504