CAZyme Information: CAWG_04353-T-p1

Basic Information

• Species: Candida albicans
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida albicans
• CAZyme ID: CAWG_04353-T-p1
• CAZy Family: GT33
• CAZyme Description: Ortholog(s) have mannosyltransferase activity and plasma membrane localization

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
755	Supercontig_1.5_C_albicans_WO-1|CGC3	86681.97	9.1455

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CalbicansWO1	6160	294748	0	6160

• Gene Location: location=Supercontig_1.5_C_albicans_WO-1:1254792-1257059(+)

Full Sequence      

MSQTLKKRGGNSSGRKSPTTSNIEFDDKKTEFDLNAIVPPKEPEYKYLAALTLVTLLAIY
TRFTKLGTPNKVVFDEVHFGKFASYYLERTYFFDLHPPFAKLLIAFVGWLIGYDGKFKFE
AIGDSYIENNVPYIAYRSLSAIQGAAIVPIMFLTMKTLGFSVAACLFSSIIVCFDNAQVT
DSRLILLDATLILSVALTIFSYSKFSTFRKQPFSSKWWTWLLATGVSLSCVISTKYVGVF
TYLTIGIAVIHELWILLDYRKGLTLQEFAKHFFARLWALIIVPFCIYLYWFYLHFAILTR
SGPGDAFMSSEFQETLLESPLAAHSKPVQYFDQITIKHKDTGAFLHSHQHEYPLRYEDGR
ISSNGQQVTCVVQENAANDPNNQWEIVPTSEGANKGTKVYTNDIVRFRHVGTGGYLLTHD
VASPLKPTNEEFTVVYDDVAQQRYNETLFRLRLHVPGSNPKKEKNKKEIKTLATDLRILH
VDTVVAMWTHNDELLPEWAFNQQEVSGNKKIPDKDNIWNFDLITNLQSTDPRNQYVPKKV
KTLPFLRKWWELQMLMFHHNNQLSSEHPFATQPGEWPLALSGVSFYNDNTEKKQIFFIGN
IIGFWLEVCFLSIYIGILLADQITRRRNIHVLSDRARSRLYNTLGFLFVGWAAHYLPFFL
MNRQKFLHHYLPAHLVAALFSGGLVEFICSNNSARPNGKPVGVNKYKIIAVVAACSTAII
WFFFYFRPLTYGDVYLTPEEVKARQWLDIKLHYGK

Enzyme Prediction     

EC	2.4.1.109:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	54	295	1.7e-68	0.9910313901345291

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224839	PMT1	0.0	59	748	35	691	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
396786	PMT	1.41e-79	60	299	9	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
406576	PMT_4TMC	3.30e-72	547	748	1	198	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
397103	MIR	5.12e-18	337	518	4	183	MIR domain. The MIR (protein mannosyltransferase, IP3R and RyR) domain is a domain that may have a ligand transferase function.
197746	MIR	9.49e-09	327	388	3	56	Domain in ryanodine and inositol trisphosphate receptors and protein O-mannosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOW27618.1|GT39	0.0	1	755	1	755
CAX43831.1|GT39	0.0	1	755	1	755
CCE40454.1|GT39	0.0	1	755	1	767
CCG22319.1|GT39	0.0	1	755	1	768
CAG88909.2|GT39	0.0	1	755	1	754

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P25_A	1.21e-92	19	747	6	724	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_A Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
6P25_B	1.92e-91	55	732	72	734	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_B Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
6P28_A	4.94e-09	342	525	22	195	Crystal structure of the MIR domain (aa 337-532) of the S. cerevisiae mannosyltransferase Pmt2 [Saccharomyces cerevisiae]
6ZQP_A	6.56e-09	342	525	39	212	Structure of the Pmt2-MIR domain with bound ligands [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59X23|PMT4_CANAL	0.0	1	755	1	755	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMT4 PE=2 SV=2
sp|P46971|PMT4_YEAST	2.06e-272	39	755	44	762	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT4 PE=1 SV=1
sp|O42933|PMT4_SCHPO	3.65e-197	46	748	57	768	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ogm4 PE=3 SV=1
sp|Q8R2R1|POMT1_MOUSE	2.06e-107	51	748	41	738	Protein O-mannosyl-transferase 1 OS=Mus musculus OX=10090 GN=Pomt1 PE=1 SV=1
sp|Q99PR0|POMT1_RAT	1.25e-104	51	748	41	738	Protein O-mannosyl-transferase 1 OS=Rattus norvegicus OX=10116 GN=Pomt1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999930	0.000060

TMHMM  Annotations     

Start	End
91	113
150	172
184	203
218	240
276	298
596	618
639	661
666	688
708	725