CAZyme Information: CAWG_04074-T-p1

Basic Information

• Species: Candida albicans
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida albicans
• CAZyme ID: CAWG_04074-T-p1
• CAZy Family: GT3
• CAZyme Description: Has domain(s) with predicted transferase activity, transferring glycosyl groups activity, role in GPI anchor biosynthetic process and intrinsic to endoplasmic reticulum membrane localization

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
236	Supercontig_1.5_C_albicans_WO-1|CGC7	27946.54	7.2846

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CalbicansWO1	6160	294748	0	6160

• Gene Location: location=Supercontig_1.5_C_albicans_WO-1:618571-619281(-)

Full Sequence      

MIKINFNWRTFYLLTIVFRFVFTLSDSYIHPDEHFQSLEVLTNRILNYSTNIPWEFQDDP
ARSLAPLYFIYGTLLYFIKFFKLNLTALQIWYIARLQISILSWIITDFCLYWMLPSKPER
IKAIFFTSTSYITLVYQNHLFSNSIETLLLLVTILLIDDLRYVQESKDQDVQNLNKNKNL
FYTGVLISLGIFNRITFPAFFDSSWLVCNEVCAQALRQWIILSHGVLFNYGLTNTS

Enzyme Prediction     

No EC number prediction in CAWG_04074-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT22	12	201	1.9e-30	0.42930591259640105

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
281842	Glyco_transf_22	8.86e-13	10	201	1	183	Alg9-like mannosyltransferase family. Members of this family are mannosyltransferase enzymes. At least some members are localized in endoplasmic reticulum and involved in GPI anchor biosynthesis.
215437	PLN02816	0.005	9	111	39	137	mannosyltransferase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOW27344.1|GT22	5.32e-136	1	211	1	212
CAX43561.1|GT22	1.35e-125	1	211	9	220
CCG21479.1|GT22	6.48e-88	7	227	39	258
CCE43516.1|GT22	3.29e-83	7	233	6	216
CCE78449.1|GT22	5.47e-77	7	200	8	202

PDB Hits     

CAWG_04074-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A0L9|SMP3_CANAL	9.46e-137	1	211	1	212	GPI mannosyltransferase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SMP3 PE=3 SV=2
sp|Q6BJ96|SMP3_DEBHA	9.96e-78	2	200	3	202	GPI mannosyltransferase 4 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=SMP3 PE=3 SV=2
sp|Q5BAX7|SMP3_EMENI	1.71e-35	8	228	2	221	GPI mannosyltransferase 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=smp3 PE=3 SV=2
sp|Q2UTP0|SMP3_ASPOR	1.36e-31	8	200	2	193	GPI mannosyltransferase 4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=smp3 PE=3 SV=1
sp|Q4WTT7|SMP3_ASPFU	2.46e-30	8	200	2	192	GPI mannosyltransferase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=smp3 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.248537	0.751440	CS pos: 27-28. Pr: 0.6985

TMHMM  Annotations     

Start	End
5	22
64	81
93	115
135	157
178	200
215	232