CAZyme Information: CAWG_03569-T-p1

Basic Information

• Species: Candida albicans
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida albicans
• CAZyme ID: CAWG_03569-T-p1
• CAZy Family: GT2
• CAZyme Description: Ortholog(s) have 1,3-beta-glucanosyltransferase activity, role in growth of symbiont in host, single-species biofilm formation on inanimate substrate, fungal-type cell wall organization, pathogenesis, single-species biofilm formation in or on host organism

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
308	Supercontig_1.4_C_albicans_WO-1|CGC2	33655.51	4.3304

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CalbicansWO1	6160	294748	0	6160

• Gene Location: location=Supercontig_1.4_C_albicans_WO-1:1186512-1187438(+)

Full Sequence      

MQIKFLTTLATVLTSVAAMGDLAFNLGVKNDDGTCKDVSTFEGDLDFLKSHSKIIKTYAV
SDCNTLQNLGPAAEAEGFQIQLGIWPNDDAHFEAEKEALQNYLPKISVSTIKIFLVGSEA
LYREDLTASELASKINDIKDLVKGIKDKNGKSYSSVPVGTVDSWNVLVDGASKPAIDAAD
VVYSNSFSYWQKNSQANASYSLFDDVMQALQTLQTAKGSTDIEFWVGETGWPTDGSSYGD
SVPSVENAADQWQKGICALRAWGINVAVYEAFDEAWKPDTSGTSSVEKHWGVWQSDKTLK
YSIDCKFN

Enzyme Prediction     

EC	3.2.1.39:6	3.2.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	23	305	1.8e-44	0.9935691318327974

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
366033	Glyco_hydro_17	9.98e-129	22	305	1	309	Glycosyl hydrolases family 17.
227625	Scw11	3.21e-96	15	297	39	305	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAY05234.1|GH17	6.39e-229	1	308	1	308
AOW28996.1|GH17	2.60e-228	1	308	1	308
AAV05244.1|GH17|3.2.1.-	1.87e-227	1	308	35	342
CAY05240.1|GH17|3.2.1.-	5.04e-226	1	308	1	308
AAA21151.1|GH17|3.2.1.-	5.04e-226	1	308	1	308

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	8.43e-32	25	303	41	292	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	6.22e-31	25	303	41	292	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AMT2|BGL2_CANAL	4.62e-229	1	308	1	308	Glucan 1,3-beta-glucosidase BGL2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BGL2 PE=1 SV=2
sp|P43070|BGL2_CANAX	8.95e-227	1	308	1	308	Glucan 1,3-beta-glucosidase OS=Candida albicans OX=5476 GN=BGL2 PE=3 SV=1
sp|P15703|BGL2_YEAST	5.97e-148	4	308	2	313	Glucan 1,3-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BGL2 PE=1 SV=1
sp|O13990|BGL2_SCHPO	6.75e-85	20	305	40	318	Glucan 1,3-beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bgl2 PE=2 SV=4
sp|D4B2W4|BGL2_ARTBC	1.06e-69	4	308	2	304	Glucan 1,3-beta-glucosidase ARB_02797 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02797 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000251	0.999721	CS pos: 18-19. Pr: 0.9774

TMHMM  Annotations     

There is no transmembrane helices in CAWG_03569-T-p1.