CAZyme Information: CAWG_03358-T-p1

Basic Information

• Species: Candida albicans
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida albicans
• CAZyme ID: CAWG_03358-T-p1
• CAZy Family: GT15
• CAZyme Description: Ortholog(s) have glucanosyltransferase activity and cell surface, anchored to plasma membrane, cellular bud membrane, cellular bud scar, cell septum, yeast-form cell wall, extracellular region, membrane raft, hyphal cell wall localization

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
548	Supercontig_1.4_C_albicans_WO-1|CGC3	59456.87	4.6517

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CalbicansWO1	6160	294748	0	6160

• Gene Location: location=Supercontig_1.4_C_albicans_WO-1:636238-637884(+)

Full Sequence      

MYSLIKSLATFATLFSLTLAKFESSTPPVEVVGNKFYFSNNGSQFLIRGIAYQQDAAGSV
SSGYDADPNRKYNDPLADADACKRDVKYFKESNTNTLRVYAIDPDKDHEECMKIFSDAGI
YIVADLSEPTVSINRNNPEWNLDLYKRYTKVIDKMQEYSNVLGFFAGNEVTNNRSNTDAS
AFVKAAIRDMKKYIKESDYRQIPVGYSSNDDEEIRVAIADYFSCGSLDDRADFFGINMYE
WCGKSTFETSGYKDRTEEIKNLTIPAFFSEYGCNANRPRLFQEIGTLYSDKMTDVWSGGI
VYMYFEEANKYGLVSVDGNSVKTLSDYNNYKSEMNKISPSLAHTSTLSSSDASKTLQCPG
TAASTWKAATNLPPTPDESYCDCISKSLECVVADDVDKEDYGDLFGQVCGYIDCSAISAD
GSKGEYGVASFCSDKDRLSYVLNQYYLDQDKKSSACDFKGSASINSKASASGSCKAVSGV
ATGKASSSGGSSKSGSSSASASGSSSSSTSSGSSSSSGVKATQQMSMVKLVSIITIVTAF
VGGMSVVF

Enzyme Prediction     

EC	2.4.1.-:30	2.4.1.-:33

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH72	24	337	1.7e-139	0.9903846153846154
CBM43	390	475	2.8e-22	0.9759036144578314

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397351	Glyco_hydro_72	0.0	20	338	3	315	Glucanosyltransferase. This is a family of glycosylphosphatidylinositol-anchored beta(1-3)glucanosyltransferases. The active site residues in the Aspergillus fumigatus example are the two glutamate residues at 160 and 261.
400371	X8	3.44e-32	388	463	1	76	X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains.
197867	X8	4.33e-23	390	476	3	85	Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAF73430.1|CBM43|GH72|2.4.1.-	0.0	1	548	1	548
AOW29201.1|CBM43|GH72|2.4.1.-	0.0	1	548	1	548
AAA68196.1|CBM43|GH72|2.4.1.-	0.0	1	548	1	548
AAF73429.1|CBM43|GH72|2.4.1.-	0.0	1	548	1	548
AAP63935.1|CBM43|GH72|2.4.1.-	0.0	1	548	1	552

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2W62_A	1.80e-137	26	446	33	456	Saccharomyces cerevisiae Gas2p in complex with laminaripentaose [Saccharomyces cerevisiae],2W63_A Saccharomyces Cerevisiae Gas2p In Complex With Laminaritriose And Laminaritetraose [Saccharomyces cerevisiae],5O9O_A Crystal structure of ScGas2 in complex with compound 7. [Saccharomyces cerevisiae S288C],5O9P_A Crystal structure of Gas2 in complex with compound 10 [Saccharomyces cerevisiae S288C],5O9Q_A Crystal structure of ScGas2 in complex with compound 6 [Saccharomyces cerevisiae S288C],5O9R_A Crystal structure of ScGas2 in complex with compound 9 [Saccharomyces cerevisiae S288C],5O9Y_A Crystal structure of ScGas2 in complex with compound 11 [Saccharomyces cerevisiae S288C],5OA2_A Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_B Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_C Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA6_A Crystal structure of ScGas2 in complex with compound 12 [Saccharomyces cerevisiae S288C]
5FIH_A	5.08e-137	26	446	33	456	SACCHAROMYCES CEREVISIAE GAS2P (E176Q MUTANT) IN COMPLEX WITH LAMINARITETRAOSE AND LAMINARIPENTAOSE [Saccharomyces cerevisiae]
2W61_A	5.08e-137	26	446	33	456	Saccharomyces cerevisiae Gas2p apostructure (E176Q mutant) [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P43076|PHR1_CANAL	0.0	1	548	1	548	pH-responsive protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PHR1 PE=2 SV=4
sp|O74137|EPD2_CANMA	2.87e-282	1	548	1	548	Protein EPD2 OS=Candida maltosa OX=5479 GN=EPD2 PE=3 SV=1
sp|P56092|EPD1_CANMA	3.78e-198	3	476	5	463	Protein EPD1 OS=Candida maltosa OX=5479 GN=EPD1 PE=3 SV=1
sp|P22146|GAS1_YEAST	9.89e-191	1	488	2	480	1,3-beta-glucanosyltransferase GAS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GAS1 PE=1 SV=2
sp|O13318|PHR2_CANAL	2.06e-186	27	476	26	463	pH-responsive protein 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PHR2 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000304	0.999667	CS pos: 20-21. Pr: 0.9830

TMHMM  Annotations     

There is no transmembrane helices in CAWG_03358-T-p1.