CAZyme Information: CAWG_02023-T-p1

Basic Information

• Species: Candida albicans
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida albicans
• CAZyme ID: CAWG_02023-T-p1
• CAZy Family: GH3
• CAZyme Description: Has domain(s) with predicted flavin adenine dinucleotide binding, long-chain-alcohol oxidase activity and role in oxidation-reduction process

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
704		77497.20	7.6493

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CalbicansWO1	6160	294748	0	6160

• Gene Location: location=Supercontig_1.2_C_albicans_WO-1:1576388-1578502(-)

Full Sequence      

MDSIFPSKVEYKQIDTFIALCDGLIYDTTVDEIKDVIAPDFPQEKLQEYVKTFTRPSQTP
GFREAIYDTINSNTTNASRSFGILCNILGSRILAPTLTNSLTPIKDMTLKERETLLASWR
DSPLAAKRRLFRAICALSGTTIVRLASELHLKAIHFPQRDLRETAYEGQVIDPFRYDFME
KPSFEGAEIYLPDIDVIIIGSGAGSGVVAHTLANDGYKTLVLEKGKYFSASELQFDDHTG
VKQLYQGGGAVATLNQQMLILAGSTFGGGTTVNWSACIKTPFKVRKEWYDDFGVEFAATD
SYDKDQDYVFKQMSASTDGITHSLANEVIMEGGKKLGYASKEINQNSGGHPHHPCGFCHL
GCKYGIKQGSVVNWFRDAAANGSKFMEQVRVVKILNKNGIAYGVLCQDVATGVNFTITGP
KKYVVSAGSLNTPTVLANSGFKNKHIGRNLTLHPVTTVFGDFGREVQADHFHNSIMTAVC
TQVDDLDGRAHGAKIETILNAPFLQAAFLPWRGSNEFRRDLLRYNNMVAMLLITRDSTSG
TVKGDPYRPDALYVDYTINKFDRNALLQALLITADMLYIEGAKRILSPQSWVPIFESNVP
KDQRSIDDKDYVEWRKKVAGIPFDQYGAAYGSAHQMSSCRMSGKGPGYGAVDTNGKLYEC
SNVYVADASVLPTASGANPMISTMTVARHIGLGLAKDLKTKAKL

Enzyme Prediction     

No EC number prediction in CAWG_02023-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	193	690	1.5e-49	0.9562043795620438

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
366272	GMC_oxred_N	1.88e-90	244	455	4	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	2.43e-25	545	690	13	143	GMC oxidoreductase. This domain found associated with pfam00732.
225186	BetA	7.23e-24	192	697	6	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
223717	FixC	0.001	195	230	5	40	Dehydrogenase (flavoprotein) [Energy production and conversion].
395718	FAD_binding_2	0.001	195	229	1	35	FAD binding domain. This family includes members that bind FAD. This family includes the flavoprotein subunits from succinate and fumarate dehydrogenase, aspartate oxidase and the alpha subunit of adenylylsulphate reductase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK96886.1|AA3	1.76e-119	6	698	22	734
CAA61359.1|AA3_1|AA8|1.1.99.18	1.75e-07	186	689	226	760
AAC49277.1|AA3_1|AA8	1.75e-07	186	689	227	761
ALJ82902.1|AA3_1|AA8	2.30e-07	195	689	240	765
AAO32063.1|AA3_1|AA8	3.02e-07	195	689	231	756

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1NAA_A	6.43e-09	195	689	4	529	Chain A, Cellobiose dehydrogenase [Phanerodontia chrysosporium],1NAA_B Chain B, Cellobiose dehydrogenase [Phanerodontia chrysosporium]
1KDG_A	6.48e-09	195	689	9	534	Chain A, cellobiose dehydrogenase [Phanerodontia chrysosporium],1KDG_B Chain B, cellobiose dehydrogenase [Phanerodontia chrysosporium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O65709|FAO4A_ARATH	4.84e-79	110	701	98	725	Long-chain-alcohol oxidase FAO4A OS=Arabidopsis thaliana OX=3702 GN=FAO4A PE=3 SV=2
sp|Q9LW56|FAO3_ARATH	1.35e-75	195	700	234	742	Long-chain-alcohol oxidase FAO3 OS=Arabidopsis thaliana OX=3702 GN=FAO3 PE=1 SV=1
sp|B5WWZ8|FAO1_LOTJA	1.86e-72	195	699	238	745	Long-chain-alcohol oxidase FAO1 OS=Lotus japonicus OX=34305 GN=FAO1 PE=1 SV=1
sp|B5WWZ9|FAO2_LOTJA	1.33e-71	158	699	201	747	Long-chain-alcohol oxidase FAO2 OS=Lotus japonicus OX=34305 GN=FAO2 PE=2 SV=1
sp|Q94BP3|FAO4B_ARATH	1.60e-68	185	704	229	748	Long-chain-alcohol oxidase FAO4B OS=Arabidopsis thaliana OX=3702 GN=FAO4B PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000080	0.000000

TMHMM  Annotations     

There is no transmembrane helices in CAWG_02023-T-p1.