CAZyme Information: CAWG_00965-T-p1

Basic Information

• Species: Candida albicans
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; Candida albicans
• CAZyme ID: CAWG_00965-T-p1
• CAZy Family: CBM21
• CAZyme Description: Has domain(s) with predicted transferase activity, transferring hexosyl groups activity, role in GPI anchor biosynthetic process and endoplasmic reticulum membrane, integral to membrane localization

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
394	Supercontig_1.1_C_albicans_WO-1|CGC6	45610.98	9.3008

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CalbicansWO1	6160	294748	0	6160

• Gene Location: location=Supercontig_1.1_C_albicans_WO-1:2308585-2309769(+)

Full Sequence      

MLWKLLRLFIIIKLIQLAIIYFSPCQFDTSSELIIQNLSSTSSSKSYYNVIITTILNKLI
VWDSVYFNDLFINPIQFEHQFVFCPGWIQLIKLLNIKNYYTAQLTSILISNLCHFASVIT
LYYLTNEMDMKFGLVSGLLMIISPAGVFLTGNYSENLSNLLTLLMFLTYYKSINFNDVKQ
PSNKSITNILGYIISGIFCAINFTVRANGLLLGVIYVFDLYHFIQNKSSSQIILSIITGS
ILFMTFLMTNIYHYIKFCPGREWCNNTFPSLFQFAQHHYWNVGFLKYWTPNNIPNFILVL
PVLIFNIYSLGYMYQELPKNRKLLPLIVINGLIVVGGTFFWNIQILNRITSFSPLIYWTL
AYNLKKPWAKYAIGYCIVWNFVQTGLFAAFLPPA

Enzyme Prediction     

No EC number prediction in CAWG_00965-T-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	6	394	5.7e-106	0.995085995085995

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	2.30e-35	5	394	4	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	1.15e-15	8	394	6	408	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOW26102.1|GT76	7.07e-290	1	394	1	394
CAX44663.1|GT76	1.49e-235	2	394	75	485
CCG22525.1|GT76	5.44e-178	2	394	37	432
CCE40664.1|GT76	5.86e-170	4	394	8	401
ABN67789.1|GT76	5.73e-124	4	394	8	394

PDB Hits     

CAWG_00965-T-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59VN0|GPI18_CANAL	1.26e-290	1	394	1	394	GPI mannosyltransferase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GPI18 PE=3 SV=1
sp|Q6BRZ9|GPI18_DEBHA	6.36e-105	7	394	9	428	GPI mannosyltransferase 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=GPI18 PE=3 SV=1
sp|Q6C216|GPI18_YARLI	6.32e-57	9	394	11	357	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1
sp|Q6CMW6|GPI18_KLULA	4.00e-56	9	394	17	417	GPI mannosyltransferase 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=GPI18 PE=3 SV=1
sp|Q757K7|GPI18_ASHGO	1.24e-51	4	394	6	427	GPI mannosyltransferase 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.760284	0.239716

TMHMM  Annotations     

Start	End
5	22
103	125
132	154
189	211
232	254
288	310
323	345
371	393