CAZyme Information: CAR65907.1

Basic Information

• Species: Debaryomyces hansenii
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Debaryomyces; Debaryomyces hansenii
• CAZyme ID: CAR65907.1
• CAZy Family: GT8
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
548		63418.68	6.8470

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_DhanseniiCBS767	6698	284592	426	6272

• Gene Location: location=CR382139:353268-354914(+)

Full Sequence      

MKNYDQYKEFFSSMSLSLDFNWRYVYLIAIGLKFVLALSNSYIHPDEHFQSFEVLTNKIF
SFTTTTPWEFSSDTPARSFGPLYLFYAPLLYSIKLVGYELSPLQIWYMARLQNVLIGWVI
TDMCIYRLLPTKPERIKGLFYTSTSYITLVYQSHCFSNSIETWLVLICVLVINDLRFIQE
SNVPELQSQRQYQKLFWFGALVSIGIFNRITFPAFLALPSLYLMKYFRHNKMSAIFSLLG
FMLPTIAIILLDTFEFNGSIDDILKHPLDFNSYVITPLNNLIYNSKVENLSNHGLHPYYT
HLLVNLPQILGPGLFFMVSNFKNQYWKTTPFLAVISGVSVLSLIPHQELRFLIPIVPLVC
CCFDLKNISSASKGERITKAPPMVSVLMNLWYLFNILLAVLMGVYHQGGIVPALDYFHSN
IFQENSRQSVQIWWRTYSPPPWILGDKLDTLQVLTVTDDSPQFELDSSKSNYLIDAMGSD
YTHVSKLIESFKDFSGSIYLIAPIASIRKHYDISMHQVWNYTHHLDLDHIDFSDFQSLKP
GLGIYELL

Enzyme Prediction     

No EC number prediction in CAR65907.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT22	26	442	1.7e-76	0.9845758354755784

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
281842	Glyco_transf_22	1.49e-50	24	442	1	410	Alg9-like mannosyltransferase family. Members of this family are mannosyltransferase enzymes. At least some members are localized in endoplasmic reticulum and involved in GPI anchor biosynthesis.
215437	PLN02816	8.53e-10	23	478	39	482	mannosyltransferase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAR65907.1|GT22	0.0	1	548	1	548
ABN64303.2|GT22	6.03e-204	20	548	5	507
QEL62156.1|GT22	2.64e-192	14	548	1	525
CCE78449.1|GT22	1.18e-190	21	548	8	534
CCE79035.1|GT22	1.18e-190	21	548	8	534

PDB Hits     

CAR65907.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6BJ96|SMP3_DEBHA	0.0	14	548	1	535	GPI mannosyltransferase 4 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=SMP3 PE=3 SV=2
sp|Q5A0L9|SMP3_CANAL	8.51e-187	16	548	2	498	GPI mannosyltransferase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SMP3 PE=3 SV=2
sp|Q6CDD0|SMP3_YARLI	2.25e-100	21	548	4	510	GPI mannosyltransferase 4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=SMP3 PE=3 SV=1
sp|Q6CU99|SMP3_KLULA	2.15e-99	24	547	6	501	GPI mannosyltransferase 4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=SMP3 PE=3 SV=2
sp|Q04174|SMP3_YEAST	1.80e-97	20	547	4	513	GPI mannosyltransferase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SMP3 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000009	0.000003

TMHMM  Annotations     

Start	End
21	43
79	101
195	217
232	251
383	405