CAZyme Information: CAR65573.1

Basic Information

• Species: Debaryomyces hansenii
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Debaryomyces; Debaryomyces hansenii
• CAZyme ID: CAR65573.1
• CAZy Family: GT62
• CAZyme Description: DEHA2C13508p [Source:UniProtKB/TrEMBL;Acc:B5RTB1]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
376	CR382135|CGC11	43502.04	8.7795

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_DhanseniiCBS767	6698	284592	426	6272

• Gene Location: location=CR382135:1185394-1186524(+)

Full Sequence      

MIKKRIEVIVKVVAILYLIYLFCRSFSVPKYKSKTEFHTNTLDSIKELEHHTNWLKYGFK
FHSNARANLPEHATLRQQLSFQFPYEPAKPFQKNIWQTWKVPIEHPNFPKKYKKYQATWD
DKNPGYKHYVIPDESCEQLINQLYATVPDVARAYNIMPKSILKADFFRYLILYAKGGLYT
DIDTISIKPIDTWVSMNETVDGSPNMAGLVVGIEADPDREDWADWYARRIQFCQWTIQAK
RGHPMLRELISRITDITLTREKKGQLNKILGKDAGGDIMNWTGPGIWTDVVFEYMNNISQ
PPDNFKTKTYDDIINVSVFTGMTIPVAIQDVLVLPITSFSPDVGQMGAKDTSHPMAYAKH
MFSGSWKPEDEKIINT

Enzyme Prediction     

EC	2.4.1.257:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	111	195	3.2e-22	0.9555555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	5.20e-41	62	367	53	345	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.13e-16	109	193	1	86	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAR65573.1|GT32	1.36e-287	1	376	1	376
ABN65126.2|GT32	9.23e-192	1	370	1	370
QFZ43557.1|GT32	6.01e-185	3	367	5	369
QFZ32205.1|GT32	6.01e-185	3	367	5	369
QFZ37874.1|GT32	6.01e-185	3	367	5	369

PDB Hits     

CAR65573.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A4E3|OCH1_CANAL	1.59e-180	1	369	9	378	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P31755|OCH1_YEAST	8.41e-93	74	372	79	475	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q9UTR6|OCH1_SCHPO	2.79e-75	81	369	134	396	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P47124|HOC1_YEAST	9.62e-66	70	367	109	388	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|Q10323|IMT3_SCHPO	1.22e-07	93	212	59	177	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.938914	0.061115

TMHMM  Annotations     

Start	End
9	28