CAZyme Information: CAP99712:RNA-p1

Basic Information

• Species: Penicillium rubens
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicillium; Penicillium rubens
• CAZyme ID: CAP99712:RNA-p1
• CAZy Family: GT8
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
846		92078.70	4.9818

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PrubensWisconsin54-1255	14021	500485	1464	12557

• Gene Location: location=Pc00c22:5709874-5712414(+)

Full Sequence      

MASDTISTIVERLLQSLTLEEKVSLVAGQNMWQTAQIERLGIPPLQMTDGPAGARGTKWT
DGSLTTLVPCAISLAATWDPSMVKRVGTVLGEETHRKGCHVLLAPTMNFSRSPLGGRNFE
GYGEDPFLIGTMSTEMIRGIQSEGVGACMKHFILNDTETRRFNVNQTIDERTLREVYMKP
FFMALEASPWTAMVSYPLVNGVHADMSSFVLPKLLRDELQFDRLVMSDWGGCNDTVRSLI
AGTDLEMPGPPVRRGQRLLAAIQEGLVDEAHHLNPSVRRVLQLLEKANLLPSQPTVQSSE
EASNAAEFPKIVREAAECGLVLLKNDGLLPLQPSSLKKVTIIGPNARKPTAGGAGSAAVN
PLYITTPEESLKHALQKANPAIEISYEQGVPFTLRPGLLGDALVIPDGSKLGLQVDFFAG
HEFQGPVVATTFWANSLAYMMSDGDVPESLKGKPYCYRASGVVTPKVCGQYVFSIANTGK
AKLFLDDKLIIDNTDWTTTTGGFLGCSSEDRTCSVELSSTRSYVLRVDNVVTLPLMESFD
NTLFPRISGLRIGLSLQVDETEMLNRAVKSAQESDVAILVVGHNKDSEGEGGDRPNMDLP
GRTNELVSSVCAANPNTVVVVQAASATAMPWADQAHAIVLGWYQGQENGPALANALLGTC
NFSGKTPITFPKNLGDHGSSDWFPAEAARDHAVFGEQVLMGYRSFEERNIEPLWPFGFGL
SYTSFTLSNIHLSGTLTTFPGSHVTIHVTVNNTGQCDGHEVVQVYVSPSVCIRERGLVSY
PNTLAGFTKVWVPAMESRDSSIVIKSDEFRWYDEEISSWRVDTGDYRCFVGTSVKDIKCE
LAVEIV

Enzyme Prediction     

No EC number prediction in CAP99712:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	35	248	5.3e-64	0.9907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	2.24e-69	29	352	45	370	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	1.00e-59	33	838	95	758	beta-glucosidase BglX.
395747	Glyco_hydro_3	4.35e-43	13	283	36	316	Glycosyl hydrolase family 3 N terminal domain.
396478	Glyco_hydro_3_C	6.87e-43	551	722	68	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	9.20e-32	2	845	45	779	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP99712.1|GH3	0.0	1	846	1	846
QMW31943.1|GH3	0.0	10	846	9	852
QRD91011.1|GH3	0.0	10	841	11	849
QMW43976.1|GH3	0.0	10	846	9	852
BAE61700.1|GH3	0.0	10	846	9	852

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.66e-145	10	837	6	828	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	3.18e-141	10	837	6	828	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	8.67e-108	10	845	5	668	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	4.01e-97	17	845	12	663	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
4I3G_A	3.06e-96	13	845	57	828	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BFG8|BGLB_EMENI	1.99e-169	10	844	11	839	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|P27034|BGLS_RHIRD	2.08e-164	10	845	2	810	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
sp|Q2U8Y5|BGLI_ASPOR	5.19e-157	10	844	6	831	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|B8NDE2|BGLI_ASPFN	5.68e-156	10	844	6	831	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
sp|Q0CAF5|BGLI_ASPTN	1.13e-151	10	844	6	831	Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000041	0.000000

TMHMM  Annotations     

There is no transmembrane helices in CAP99712:RNA-p1.