CAZyme Information: CAP99360:RNA-p1

Basic Information

• Species: Penicillium rubens
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicillium; Penicillium rubens
• CAZyme ID: CAP99360:RNA-p1
• CAZy Family: GT62
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
337	Pc00c22|CGC20	38251.34	4.8310

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PrubensWisconsin54-1255	14021	500485	1464	12557

• Gene Location: location=Pc00c22:4904607-4905802(+)

Full Sequence      

MFSNGSIVCKDDYFAAAVGSMLSNLDRRERRALYLSVLFANTDPTQHPSWGQKWLERVVD
SVSTYNVSAEEFRYLQKLEEERNFYEKGVYDYIYLLNQCLETGAPYMLVLEDDVIFADGW
LVKTLNGLYTLSHGPTARSGSWIYLRLFFTETSLAWSTSDFWYRNMLLAFGLVIGSGYAL
LSAVRRYWPSTRGFLNNWTVAAICLVVAPAFTGLVYMIGKYSLFPLQGVVEMNGHGCCTQ
GLVFPREQVPALVARLQEKKSGQTDSLIEEYAIDSGLTRLALAPQQLQHVGLQSSRDNLE
INTQSTWAFWFEENDASELNIEHKRLVAASDDDWHLG

Enzyme Prediction     

No EC number prediction in CAP99360:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT109	11	328	6e-121	0.7664233576642335

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
409190	PGAP4-like_fungal	1.81e-149	11	298	87	375	uncharacterized fungal proteins similar to Post-GPI attachment to proteins factor 4. This subfamily contains uncharacterized fungal proteins with similarity to animal post-GPI attachment to proteins factor 4 (PGAP4), also known as post-GPI attachment to proteins GalNAc transferase 4 or transmembrane protein 246 (TMEM246). PGAP4 has been shown to be a Golgi-resident GPI-GalNAc transferase. Many eukaryotic proteins are anchored to the cell surface through glycolipid glycosylphosphatidylinositol (GPI). GPIs have a conserved core but exhibit diverse N-acetylgalactosamine (GalNAc) modifications. PGAP4 knockout cells lose GPI-GalNAc structures. PGAP4 is most likely involved in the initial steps of GPI-GalNAc biosynthesis. In contrast to other Golgi glycotransferases, it contains three transmembrane domains. Proteins from this subfamily contain the putative catalytic site of PGAP4 and may have similar activities.
409189	PGAP4-like	3.96e-36	13	295	85	361	Post-GPI attachment to proteins factor 4 and similar proteins. This family includes post-GPI attachment to proteins factor 4 (PGAP4), also known as post-GPI attachment to proteins GalNAc transferase 4 or transmembrane protein 246 (TMEM246). PGAP4 has been shown to be a Golgi-resident GPI-GalNAc transferase. Many eukaryotic proteins are anchored to the cell surface through glycolipid glycosylphosphatidylinositol (GPI). GPIs have a conserved core but exhibit diverse N-acetylgalactosamine (GalNAc) modifications. PGAP4 knockout cells lose GPI-GalNAc structures. PGAP4 is most likely involved in the initial steps of GPI-GalNAc biosynthesis. In contrast to other Golgi glycotransferases, it contains three transmembrane domains. This family also includes uncharacterized fungal proteins with similarity to PGAP4.
409191	PGAP4	8.47e-20	73	295	148	376	Post-GPI attachment to proteins factor 4. Post-GPI attachment to proteins factor 4 (PGAP4), also known as post-GPI attachment to proteins GalNAc transferase 4 or transmembrane protein 246 (TMEM246), has been shown to be a Golgi-resident GPI-GalNAc transferase. Many eukaryotic proteins are anchored to the cell surface through glycolipid glycosylphosphatidylinositol (GPI). GPIs have a conserved core but exhibit diverse N-acetylgalactosamine (GalNAc) modifications. PGAP4 knockout cells lose GPI-GalNAc structures. PGAP4 is most likely involved in the initial steps of GPI-GalNAc biosynthesis. In contrast to other Golgi glycotransferases (GTs), it contains three transmembrane domains. Structural modeling suggests that PGAP4 adopts a GT-A fold split by an insertion of tandem transmembrane domains.
225843	COG3306	6.06e-06	16	231	1	210	Glycosyltransferase involved in LPS biosynthesis, GR25 family [Cell wall/membrane/envelope biogenesis].
133474	Glyco_transf_25	1.85e-05	24	120	6	99	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP99360.1|GT109	1.50e-253	1	337	1	337
QGA19659.1|GT109	2.12e-128	12	323	111	420
BCR99311.1|GT109	3.42e-128	11	327	111	426
BCS11615.1|GT109	3.42e-128	11	327	111	426
CAK46547.1|GT109	2.77e-127	11	327	111	426

PDB Hits     

CAP99360:RNA-p1 has no PDB hit.

Swiss-Prot Hits     

CAP99360:RNA-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000028	0.000000

TMHMM  Annotations     

Start	End
162	184
197	219