CAZyme Information: CAP99070:RNA-p1

Basic Information

• Species: Penicillium rubens
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicillium; Penicillium rubens
• CAZyme ID: CAP99070:RNA-p1
• CAZy Family: GT57
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
412	Pc00c22|CGC19	47073.44	6.5791

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PrubensWisconsin54-1255	14021	500485	1464	12557

• Gene Location: location=Pc00c22:4221990-4223406(-)

Full Sequence      

MLLPKGGVNWKSAKARLPPWRAILVLLTRTRFLVSIALTGLLILMWRGVSRSASEMQSFY
CYGSNKSPMEMSINEMVEWSAHAQTPVLFNRHEPYEVNSTTITDLDLNPIKSTSKAALNR
ERVLILTPLRDAAPYLAKYFDLLYKLSYPHDLIDLAFLVGDCKDDTLANLASELDRIQNH
AEEKVRFRSATIIQKDFGADVEMTVAERHSFAAQGPRRKAIARARNYLLYSALKADHSWV
YWRDVDITDCPERILEDFMAHDKDILVPNIWFHRYNQDGHDIEGRFDYNSWIESDKGRRL
RASLPTDTVLAEGYKEYDTGRTYLVGMGDWRNNKDDEVELDGIGGVNILVKADVHRSGIN
FPAYAFENQAETEGFARMAKRAGYQVVGLPNYVVWHIDTDEKPGNLGDRKAF

Enzyme Prediction     

No EC number prediction in CAP99070:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT62	100	364	8.7e-108	0.9850746268656716

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397491	Anp1	7.69e-157	101	365	1	265	Anp1. The members of this family (Anp1, Van1 and Mnn9) are membrane proteins required for proper Golgi function. These proteins co-localize within the cis Golgi, and that they are physically associated in two distinct complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP99070.1|GT62	5.38e-310	1	412	1	412
QQK44843.1|GT62	4.74e-304	1	412	1	412
BCR85123.1|GT62	2.27e-266	1	406	1	405
CAK38583.1|GT62	9.65e-258	1	412	1	411
BCS12574.1|GT62	1.95e-257	1	412	1	411

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZF8_A	2.78e-64	102	400	6	303	Crystal structure of Saccharomyces cerevisiae Mnn9 in complex with GDP and Mn. [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32629|ANP1_YEAST	3.83e-91	88	397	48	355	Mannan polymerase II complex ANP1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ANP1 PE=1 SV=3
sp|O74745|ANP1_SCHPO	4.09e-91	120	397	97	372	Mannan polymerase II complex anp1 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=anp1 PE=3 SV=1
sp|P23642|VAN1_YEAST	5.32e-75	100	397	170	512	Mannan polymerase I complex VAN1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VAN1 PE=1 SV=3
sp|Q00314|VAN1_CANAX	1.18e-73	93	397	59	419	Vanadate resistance protein OS=Candida albicans OX=5476 GN=VAN1 PE=3 SV=1
sp|P53697|MNN9_CANAL	2.13e-67	102	396	73	365	Mannan polymerase complex subunit MNN9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN9 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000009	0.000006

TMHMM  Annotations     

There is no transmembrane helices in CAP99070:RNA-p1.