CAZyme Information: CAP98942:RNA-p1

Basic Information

• Species: Penicillium rubens
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicillium; Penicillium rubens
• CAZyme ID: CAP98942:RNA-p1
• CAZy Family: GT50
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
360	Pc00c22|CGC28	41098.92	6.3453

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PrubensWisconsin54-1255	14021	500485	1464	12557

• Gene Location: location=Pc00c22:3907865-3909014(-)

Full Sequence      

MITPRKVLLSLLCVVTFVLILRSFRDPEVPGAPGYRPVKKISQEEDEVTSNLARKTPPQG
RAQLPLGASPTAPLRERLRYQFPYGIENKFPAYIWQTWKYDPGSFWFDEDLRGLEASWTE
MHPGFTHEVIPDETQQHLIKYLYGSVPEVFEAYDSLPLAVMKADFFRYLVLLARGGIYSD
IDTLALRPAHTWLPEELDRSTIGLIVGIEADPDRDDWHDWYSRRLQFCQWTLVSKPGHPI
LRDMVAYVTEHALRMKRAGILKVGKMDKTIMEFTGPGAWTDSVFRYFNNPAYFNIQPGDK
NITYEDFSHQTTHRKVGDVVVLPITSFSPGVGQMGAGDPDDPMAFVKHNFGGTWKTDPSL

Enzyme Prediction     

EC	2.4.1.257:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	116	195	6.4e-20	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	6.50e-39	74	347	66	339	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.25e-16	108	196	1	90	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP98942.1|GT32	7.71e-279	1	360	1	360
QQK43274.1|GT32	4.54e-262	1	360	1	360
CBV36935.1|GT32	8.16e-189	1	360	1	359
QRD84625.1|GT32	8.96e-187	1	360	1	363
UDD58159.1|GT32	2.56e-186	1	360	1	363

PDB Hits     

CAP98942:RNA-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A4E3|OCH1_CANAL	2.13e-91	9	357	19	378	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|Q9UTR6|OCH1_SCHPO	4.32e-82	80	357	132	396	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P47124|HOC1_YEAST	5.97e-76	70	360	110	393	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	4.17e-67	74	357	80	472	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999898	0.000114

TMHMM  Annotations     

Start	End
7	24