CAZyme Information: CAP98643:RNA-p1

Basic Information

• Species: Penicillium rubens
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicillium; Penicillium rubens
• CAZyme ID: CAP98643:RNA-p1
• CAZy Family: GT32
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
421	Pc00c22|CGC6	48314.83	7.8051

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PrubensWisconsin54-1255	14021	500485	1464	12557

• Gene Location: location=Pc00c22:3206180-3207504(+)

Full Sequence      

MSLRRRIKVQASKFLSTRRGSCIIFIAFIWFIFYHLPAPPSTQNNTRADRPPPEHQVEDT
PRFIYRSPFRNNPDVRYEKQLSDALENIEKAVLARSQESNISEDKIWQIAKNQKHRGDDS
IVFQGKNKEWEYNLVTDEKAIKFVINELSAIPEIATIYKSYPHNVLRADLLRYLLLWYYG
GFYADIDVFPARTIKTCPALESFFTPTPEDYTQNTHPDVSLVVGIEVDEPYASPQFMRDW
HWTRSYGLIQYTMYAPRRFSPLLRETIVRVLAHTRKYNSEHTSLFSSPAYDEKTILGVTG
PDVFTDAILDTLSSSLPLTHPLIQQSVEADADIGDLISPTTQEVEKGVTWAPFHKLRDPV
CIQAGEAVPNKSMGGLCVLPISAWGNGQRHSQAGGFNHPKACVNHRFGRTWKKGWWEYIF
G

Enzyme Prediction     

No EC number prediction in CAP98643:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	126	197	8.7e-19	0.8111111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398274	Gly_transf_sug	4.66e-08	126	204	14	93	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
226297	OCH1	2.09e-06	103	194	83	174	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP98643.1|GT32	0.0	1	421	1	421
QQK43033.1|GT32	9.52e-245	29	421	4	395
BCS21634.1|GT32	1.31e-159	14	421	13	414
QKX54668.1|GT32	1.19e-157	31	421	27	403
QMW25899.1|GT32	3.66e-154	49	421	47	413

PDB Hits     

CAP98643:RNA-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P31755|OCH1_YEAST	9.78e-17	129	413	131	471	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q5A4E3|OCH1_CANAL	2.89e-14	122	412	126	376	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|Q9UTR6|OCH1_SCHPO	5.74e-12	130	412	172	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P47124|HOC1_YEAST	4.32e-11	122	359	153	347	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|Q10323|IMT3_SCHPO	2.05e-08	129	194	87	149	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000022	0.000005

TMHMM  Annotations     

Start	End
21	38