CAZyme Information: CAP98294:RNA-p1

Basic Information

• Species: Penicillium rubens
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicillium; Penicillium rubens
• CAZyme ID: CAP98294:RNA-p1
• CAZy Family: GT32
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
908	Pc00c22|CGC39	98876.98	6.6481

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PrubensWisconsin54-1255	14021	500485	1464	12557

• Gene Location: location=Pc00c22:2394325-2397159(+)

Full Sequence      

MGQLFMMGFDGTSVNPQIRSLIENYHLGAVLLSAKNLKSAEDTTRLVLELQTIARDAGHP
VPLLIAMDQENGGVNSLYDEIYIRQFPSTMGIAATGSKSLAHDVAVATAQELKAVGVNWI
LGPVLDVLTNVRNQPLGVRTAGDDPQEASRYGVQFMKGYQEAGLVTCGKHFPSYGNLEFL
GSQTDVPIITESLEQLSLSALVPFRNAISQGLDAMMVGGVSLSSAGMNVMHACLSDQVVD
ELLRKDLQFQGVVVSECLEMEALTHNIGVGGGTVMAKNAGCDVILLCRSFPVQQEAINGL
KLGVENGIIGRQRIEQSLRRVLDLKARCTSWEQALNPPGLSSLTQMQPSHTNLSTRAYNS
SITVMRDKNNLLPLSNVIEADEELLLLTPLVKPLPTSAVSLSVTESAHALSSERTSSVLS
GEGVFKELGRSLSRQRNGRVLHTSYTSNGVRPIHEDLIQRASAVVVVTADANRNLYQQGF
SKHVSMICQSQYNSSGERRERPLIVVAVSSPYDFAMDSSIGTYICTYDFTETALQALVKV
LYGDLTPSAALPGSIGRTQKIHQSRQHWLVENWNEDRDAFALDALLDTVRADYALGQPSE
LLGATSSSFLLRKEDVDEAHFVVRNSSTHALYGFCATYFFRSTGTGVLACLIVDPSRRKL
SIGHSLHSRAIRTLLQRSGMRRFQLGSRLPGIYLGIPTVNPVERKRLRQWFANMGWNTAL
SRPVCSVILRNLSTWVPPEGLTATLQSAEVSYDLVYGWDFAPAILDHIKTYARQGVADIY
RMALGDAPNCGIIRAKRPSDGVILGSVVIYNVRSALAEHMPVLRATQASVGGISSPVISP
CGEDYSAVMQGLILLAIKQIRKLSADAVVMDCVDGDGNFDHLSTMGFTMLHSFEEVNCDA
ATWTMMHA

Enzyme Prediction     

No EC number prediction in CAP98294:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	60	285	8.4e-53	0.9583333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	3.68e-65	2	375	8	351	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	7.42e-63	2	324	7	316	Glycosyl hydrolase family 3 N terminal domain.
235417	PRK05337	2.95e-31	1	320	1	308	beta-hexosaminidase; Provisional
178629	PLN03080	1.58e-08	86	552	114	585	Probable beta-xylosidase; Provisional
185053	PRK15098	9.36e-07	85	325	119	353	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP98294.1|GH3	0.0	1	908	1	908
QQK45530.1|GH3	0.0	1	908	19	930
BCS15461.1|GH3	0.0	1	906	19	928
BCS03847.1|GH3	0.0	1	906	1	910
BAE65506.1|GH3	0.0	1	908	48	960

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZM6_A	9.63e-92	1	750	13	711	A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
6K5J_A	2.62e-63	1	555	17	531	Structure of a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	1.80e-44	12	560	71	622	Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	2.35e-44	12	560	45	596	Chain A, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	3.49e-44	12	560	75	626	Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40406|NAGZ_BACSU	9.25e-44	12	560	71	622	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
sp|Q7WUL3|NAG3_CELFI	7.78e-35	1	375	32	399	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
sp|P48823|HEXA_PSEO7	3.63e-33	12	374	49	425	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
sp|Q6LJ30|NAGZ_PHOPR	1.68e-28	1	300	1	287	Beta-hexosaminidase OS=Photobacterium profundum (strain SS9) OX=298386 GN=nagZ PE=3 SV=1
sp|B0U3L0|NAGZ_XYLFM	1.42e-27	4	311	1	306	Beta-hexosaminidase OS=Xylella fastidiosa (strain M12) OX=405440 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000068	0.000000

TMHMM  Annotations     

There is no transmembrane helices in CAP98294:RNA-p1.