CAZyme Information: CAP97902:RNA-p1

Basic Information

• Species: Penicillium rubens
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicillium; Penicillium rubens
• CAZyme ID: CAP97902:RNA-p1
• CAZy Family: GT20
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
450		49034.14	9.3186

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PrubensWisconsin54-1255	14021	500485	1464	12557

• Gene Location: location=Pc00c22:1452524-1453989(-)

Full Sequence      

MASVQPTTRPPPLFAKLLRLDNPIRSLTLAFWSWKVLLYIVVAACPGSGYDTSTSLISYA
ADPSTVAQSESLSGPLKFARWDSIYYLDIAEKGYLFEQEWAFGWGYTKLLSIFVSGIRLS
GGDAGPASTAMVGVVLSHVAHYLSVLALYRLSANIFGHATATQHLICFLSAALHIISPAG
AFLSAPYGESIVSFLNITGFYLYSSSLIAERNGATRLRDIRVLTSAVLFAAGTMARSNGI
LSGFLFAYDAAVLAWKILTKGPTLHTTVRLAVVIVGGCIVGSGIVIPQILAYRMYCMSEG
YLRPWCEWTLPSIYGWVQNHYWDVGFLRYWTVSNIPLFLLAAPMLAILCRSSLWALQSPS
SSSTSPGSMLARLAVPQGLLAVMAFTSYHVQIINRISSGYPLWYWYLVTSAVDLRSSSPK
QSRTLVAAVYSMVAYALIQGVLFGSFLPPA

Enzyme Prediction     

No EC number prediction in CAP97902:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	30	450	2e-111	0.9901719901719902

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	8.67e-40	24	450	1	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	1.06e-21	80	450	76	408	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP97902.1|GT76	0.0	1	450	1	450
QQK45828.1|GT76	8.42e-300	1	444	1	444
BCS01167.1|GT76	2.66e-175	7	450	10	469
BCS12914.1|GT76	2.66e-175	7	450	10	469
QMW40534.1|GT76	4.20e-175	17	450	12	452

PDB Hits     

CAP97902:RNA-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2UJS7|GPI18_ASPOR	5.37e-169	17	450	12	434	GPI mannosyltransferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi18 PE=3 SV=1
sp|Q4WQ21|GPI18_ASPFU	5.88e-145	22	450	28	441	GPI mannosyltransferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi18 PE=3 SV=1
sp|Q2GSI6|GPI18_CHAGB	2.25e-90	22	450	17	471	GPI mannosyltransferase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=GPI18 PE=3 SV=1
sp|Q4I0K3|GPI18_GIBZE	2.17e-87	21	450	8	423	GPI mannosyltransferase 2 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI18 PE=3 SV=1
sp|Q6C216|GPI18_YARLI	5.34e-50	26	450	6	357	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999971	0.000056

TMHMM  Annotations     

Start	End
28	50
130	152
165	187
191	208
238	255
270	292
326	348
368	390
425	447