CAZyme Information: CAP97426:RNA-p1

Basic Information

• Species: Penicillium rubens
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicillium; Penicillium rubens
• CAZyme ID: CAP97426:RNA-p1
• CAZy Family: GT2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
816	Pc00c22|CGC32	85816.21	5.4102

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PrubensWisconsin54-1255	14021	500485	1464	12557

• Gene Location: location=Pc00c22:320395-323066(-)

Full Sequence      

MYYSSVLKYLFLLACANAQLLEIPAVDAIVSSAMLPFEQYMSFGAPTKIASAAVSFETKV
AANAKSSVAVAAAADTPYWLADIAHQGVAAFNPNPSSYKVFRNVKDYGAKGDGVTDDTAA
INAAISAGGRFGPASRQSSTTTPAIVYFPSGTYLISTSIIDYYFTQLIGNPNAMPVIKAT
AGFVGLGMIDGDQYQSDGNQGWTSTNVFFRQIRNLKLDLTAIPAATAATGIHWPTGQASS
IENVVIVMSSASGTQHQGIFIENGSGGWMTDVVITGGLYGANIGNQQFTMRNLVISNTVT
AISQIWNWGWTYQGLSLFNCTTAISISNGGAGNQLVGSVNILDSTIQNCPTFVDTAWQSS
TLSTGSLIMENINLKNVPVAVKGVSGTVLAGSTGSTTIGAWGQGHKYTPNGPTNFQGSFT
APTRPSALLAGGSNRYFTKSKPQYAQSPVASFVSIRSAGAKGDGSTDDTTVIQSTLASAA
SAGEIVFFDQGTYKVTNTIYIPPGSRIVGEAYSVIMATGSVWSSITKPVPVVQIGRSGES
GSIEWSDMIVSTSGSAPGAVLIEWNLAATSGSGMWDVHTRIGGFQGSQQQVAQCPTTAAV
SAACQVAYMSMHITKAASGVYLENVWLWTADHDLESPTNTQISVYSGRGLLVEGKNIWLY
GTGSEHHSLYQYQFSGASSICAGFVQTETPYYQPNPNAANGPYPRNLALSDPDYSSCLGG
NCNSLGLRILNTKDVIIYGAGLYSFFNNYSTSCSTFPLPENCQSMIFSTEGSTSGLVVYG
LNTVGTSYMIVKDGTALATVGDNLATYAATIAYFTF

Enzyme Prediction     

EC	3.2.1.58:16

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH55	70	815	3.4e-280	0.9918918918918919

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403800	Pectate_lyase_3	7.23e-91	101	324	1	212	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
403800	Pectate_lyase_3	8.48e-09	452	565	1	122	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
227721	Pgu1	2.32e-04	103	154	84	125	Polygalacturonase [Carbohydrate transport and metabolism].
215120	PLN02188	0.007	103	155	38	81	polygalacturonase/glycoside hydrolase family protein
314993	End_N_terminal	0.008	109	127	1	19	N terminal extension of bacteriophage endosialidase. This domain family is found in bacteria and viruses, and is approximately 70 amino acids in length. This domain is found in the bacteriophage protein endosialidase. The two N-terminal domains (this domain and the beta propeller) assemble in the compact 'cap' whereas the C-terminal domain forms an extended tail-like structure. The very N-terminal part of the 'cap' region (residues 246 to 312) holds the only alpha-helix of the protein and is presumably the residual part of the deleted N-terminal head-binding domain. The endosialidase protein complexes to form homotrimeric molecules.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP97426.1|GH55	0.0	1	816	1	816
QQK46226.1|GH55	0.0	12	816	12	817
BCR82778.1|GH55	0.0	60	814	28	780
QKX54382.1|GH55	0.0	12	816	11	806
QGA21686.1|GH55	0.0	75	807	48	779

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3EQN_A	7.12e-215	72	815	20	756	Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQN_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_A Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium]
5M5Z_A	1.95e-214	74	814	2	753	Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila],5M60_A Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila]
7CHU_A	1.46e-06	453	533	75	159	Chain A, Putative pectin lyase [Geobacillus virus E2],7CHU_B Chain B, Putative pectin lyase [Geobacillus virus E2],7CHU_C Chain C, Putative pectin lyase [Geobacillus virus E2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P49426|EXG1_COCCA	3.98e-277	49	816	15	786	Glucan 1,3-beta-glucosidase OS=Cochliobolus carbonum OX=5017 GN=EXG1 PE=1 SV=1
sp|D4B0V1|E13B_ARTBC	1.52e-201	78	814	43	873	Probable glucan endo-1,3-beta-glucosidase ARB_02077 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02077 PE=1 SV=1
sp|P53626|E13B_TRIHA	2.68e-58	117	781	71	723	Glucan endo-1,3-beta-glucosidase BGN13.1 OS=Trichoderma harzianum OX=5544 GN=bgn13.1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.002464	0.997510	CS pos: 18-19. Pr: 0.9573

TMHMM  Annotations     

There is no transmembrane helices in CAP97426:RNA-p1.