CAZyme Information: CAP97019:RNA-p1

Basic Information

• Species: Penicillium rubens
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicillium; Penicillium rubens
• CAZyme ID: CAP97019:RNA-p1
• CAZy Family: GH93
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
208		21906.09	8.0137

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PrubensWisconsin54-1255	14021	500485	1464	12557

• Gene Location: location=Pc00c21:5000809-5001622(-)

Full Sequence      

MKFSLLALALATAAFASPMDIDARALSEGNELRNGDCKDITFIFARASTEPGLLILTHPN
DRMSKPGKVACQGVGPKYTADLPSNALPGNTSPAAIAEAQGLFEQAAKKCPDTQILAGGY
SQGTAVMDGSIKKLSSDVQAKIKGVALFGYTRNAQERGQIQGFDKDKTKIYCAVGDMVCQ
GTLVITAAHFTYVADAGAATRWLVSKLD

Enzyme Prediction     

EC	3.1.1.74:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	37	207	5.3e-37	0.9894179894179894

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	1.86e-57	37	207	2	173	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP97019.1|CE5	1.93e-146	1	208	1	208
QMW35358.1|CE5	2.37e-94	1	208	1	213
QMW47420.1|CE5	2.37e-94	1	208	1	213
UDD64461.1|CE5	2.37e-94	1	208	1	213
BAE65128.1|CE5	1.09e-93	1	207	1	212

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3GBS_A	3.02e-91	17	207	1	196	Crystal structure of Aspergillus oryzae cutinase [Aspergillus oryzae]
3QPD_A	2.76e-87	26	207	1	187	Structure of Aspergillus oryzae cutinase expressed in Pichia pastoris, crystallized in the presence of Paraoxon [Aspergillus oryzae]
5X88_A	1.16e-62	17	208	1	199	Chain A, cutinase [Malbranchea cinnamomea]
3DCN_A	3.89e-51	27	207	10	200	Glomerella cingulata apo cutinase [Colletotrichum gloeosporioides],3DD5_A Glomerella cingulata E600-cutinase complex [Colletotrichum gloeosporioides],3DD5_B Glomerella cingulata E600-cutinase complex [Colletotrichum gloeosporioides],3DD5_C Glomerella cingulata E600-cutinase complex [Colletotrichum gloeosporioides],3DD5_D Glomerella cingulata E600-cutinase complex [Colletotrichum gloeosporioides],3DD5_E Glomerella cingulata E600-cutinase complex [Colletotrichum gloeosporioides],3DD5_F Glomerella cingulata E600-cutinase complex [Colletotrichum gloeosporioides],3DD5_G Glomerella cingulata E600-cutinase complex [Colletotrichum gloeosporioides],3DD5_H Glomerella cingulata E600-cutinase complex [Colletotrichum gloeosporioides],3DEA_A Glomerella cingulata PETFP-cutinase complex [Colletotrichum gloeosporioides],3DEA_B Glomerella cingulata PETFP-cutinase complex [Colletotrichum gloeosporioides]
1CUY_A	3.71e-49	20	207	9	207	Chain A, CUTINASE [Fusarium vanettenii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B6HLS9|CUTI1_PENRW	3.42e-147	1	208	1	208	Probable cutinase 1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) OX=500485 GN=Pc21g21220 PE=3 SV=1
sp|A1CVT3|CUTI2_NEOFI	2.73e-95	1	208	1	213	Probable cutinase 2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=NFIA_102190 PE=3 SV=1
sp|B8NBB2|CUTI2_ASPFN	4.21e-95	1	208	1	213	Probable cutinase 2 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=AFLA_044870 PE=3 SV=2
sp|Q4WQV2|CUTI2_ASPFU	1.52e-94	1	207	1	212	Probable cutinase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=AFUA_4G14120 PE=3 SV=1
sp|B0Y537|CUTI2_ASPFC	1.52e-94	1	207	1	212	Probable cutinase 2 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=AFUB_071270 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000284	0.999697	CS pos: 24-25. Pr: 0.7958

TMHMM  Annotations     

There is no transmembrane helices in CAP97019:RNA-p1.