CAZyme Information: CAP96229:RNA-p1

Basic Information

• Species: Penicillium rubens
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicillium; Penicillium rubens
• CAZyme ID: CAP96229:RNA-p1
• CAZy Family: GH71|CBM24|CBM24
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
803	Pc00c21|CGC5	87264.54	5.0756

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PrubensWisconsin54-1255	14021	500485	1464	12557

• Gene Location: location=Pc00c21:3153133-3155732(-)

Full Sequence      

MPQLKRLLVTAGFLINFVAGQDTVVHQDTHFYGQSPPIYPSPEISGTGGWNEFSKAQALV
LQMTLEEKTSLTGGYPNETSGCGGNIPAIARLGFPGMCLQDGPNGVRAADFVNGYPSGIH
VGASWNKTLAYSQSHAIGGEFRRKGATVALGPPVLGPLGRIALGGRNWETYSNDPYLTGA
LGAEAVKGVQDNGVISCTKHFVGNEQEMHRNPRVDPDTNTTIEASSSNIDDRTMHEHYMW
PFADAVHAGTASIMCAYERLNNSYSCHNSKLLNGLLKTELGFQGFVVSDWFAQHTGIASA
TAGLDMVMPYGYEFWGDNLTEAVRNGSISEGHINNMATRIMAAWYFSHQDDKSLPPVGVG
LTANFEDRRAPTIDARDPNDAGLLMEGAIQGHVLVKNVKNSLPLKAPRMLSIYGYDAKLP
DKSFSSGGYNGWALGLQSQNYRSIVCGFGPIGGQCPAFEPIAINGTMIGGGGSGAVTPVY
MSSPFDALEKRARREGTQLFWDFNTENATSNINSNSDACLVFLNAASSEGVDRPSVRDSF
SDSLVKNIAADCDNTIVTIHNAGVRLVDEWIEHPNVTAVIFAHLPGQDSGEAITKILYGD
VSPSGKLPYSVPRNESDYGPVYAPVTHSGWDRYFPQDDFKEGVFTDYRAFDREGIDPRFE
FGFGLTYTTFEYSNLKIENTVDSSTLTSYPMGPIIPGGHSDLWDTIATVTADVTNTGSVE
AAEIAQLYVGIPMQDQPIRQLRGFDKVTVPPEETRTVEFKLRRRDLSTWDVHGQNWRLLV
GSDYPVYVGASSRNLKLSANLSL

Enzyme Prediction     

EC	3.2.1.21:10	3.2.1.37:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	89	309	3.2e-59	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	7.86e-42	87	431	53	378	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	2.43e-41	393	647	2	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
185053	PRK15098	1.96e-38	165	770	168	734	beta-glucosidase BglX.
395747	Glyco_hydro_3	3.01e-32	115	340	88	313	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	8.45e-26	54	759	51	740	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP96229.1|GH3	0.0	1	803	1	803
QMW36032.1|GH3	0.0	1	803	1	796
QRD93012.1|GH3	0.0	1	803	1	796
UDD65245.1|GH3	0.0	1	803	1	796
BAE65597.1|GH3|3.2.1.21	0.0	1	803	1	796

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SZ6_A	6.35e-183	32	802	1	836	Chain A, Beta-glucosidase [Thermochaetoides thermophila]
5JU6_A	7.18e-178	35	801	25	851	Chain A, Beta-glucosidase [Rasamsonia emersonii],5JU6_B Chain B, Beta-glucosidase [Rasamsonia emersonii],5JU6_C Chain C, Beta-glucosidase [Rasamsonia emersonii],5JU6_D Chain D, Beta-glucosidase [Rasamsonia emersonii]
6JBS_A	7.60e-177	39	798	49	798	Bifunctional xylosidase/glucosidase LXYL [Lentinula edodes],6JBS_B Bifunctional xylosidase/glucosidase LXYL [Lentinula edodes],6JBS_C Bifunctional xylosidase/glucosidase LXYL [Lentinula edodes],6JBS_D Bifunctional xylosidase/glucosidase LXYL [Lentinula edodes]
6KJ0_A	2.13e-176	39	798	49	798	Bifunctional xylosidase/glucosidase LXYL mutant E529Q C2221 [Lentinula edodes],6KJ0_B Bifunctional xylosidase/glucosidase LXYL mutant E529Q C2221 [Lentinula edodes]
5NBS_A	2.16e-173	35	797	20	852	Structural studies of a Glycoside Hydrolase Family 3 beta-glucosidase from the Model Fungus Neurospora crassa [Neurospora crassa OR74A],5NBS_B Structural studies of a Glycoside Hydrolase Family 3 beta-glucosidase from the Model Fungus Neurospora crassa [Neurospora crassa OR74A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B8N5S6|BGLM_ASPFN	1.17e-280	11	803	12	768	Probable beta-glucosidase M OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglM PE=3 SV=1
sp|Q2UDK7|BGLM_ASPOR	6.71e-280	11	803	12	768	Probable beta-glucosidase M OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglM PE=3 SV=1
sp|Q0C7L4|BGLM_ASPTN	7.71e-280	11	803	12	782	Probable beta-glucosidase M OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglM PE=3 SV=1
sp|A5ABF5|BGLM_ASPNC	2.80e-278	1	803	1	765	Probable beta-glucosidase M OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=bglM PE=3 SV=1
sp|Q4WR62|BGLM_ASPFU	4.56e-278	4	803	10	769	Probable beta-glucosidase M OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglM PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000262	0.999701	CS pos: 20-21. Pr: 0.9761

TMHMM  Annotations     

There is no transmembrane helices in CAP96229:RNA-p1.