CAZyme Information: CAP93841:RNA-p1

Basic Information

• Species: Penicillium rubens
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicillium; Penicillium rubens
• CAZyme ID: CAP93841:RNA-p1
• CAZy Family: GH32
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
340	Pc00c16|CGC20	37196.01	4.3152

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PrubensWisconsin54-1255	14021	500485	1464	12557

• Gene Location: location=Pc00c16:2811721-2812743(+)

Full Sequence      

MKAINATTFIIALLAATERTNAFANTGTTPLREEAAKQDILIGSGAINPTYLNDSRFAAV
LANQFNSLSPENEMKWSFLNPTEGHYNWDTIDRLVNFAEENDMAVKGHGLISSCCNPDYL
LNITDPTAFRAAMTAHFEAVMYRYNGKMDRWDVVTEALKTMGGGLSTDNDFYKVLGPGYI
DDAFHIARAADPDAKLFINENQVESLPGKRQELYDLVSGLVENGVPIDGVALQMHITEVA
PIPGVLTDIVESYKALGLEITIAEMDVHTLDTALEADIYGAVVDEALKAGITDISFWGFT
DKHAYTWLPGAKPLMFDECYNAKGAFYATHAALTNFVGAL

Enzyme Prediction     

EC	3.2.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	35	330	3.3e-82	0.9735973597359736

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214750	Glyco_10	9.20e-92	74	328	1	262	Glycosyl hydrolase family 10.
395262	Glyco_hydro_10	3.45e-87	31	328	1	307	Glycosyl hydrolase family 10.
226217	XynA	1.87e-78	20	328	13	336	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP93841.1|GH10	1.28e-251	1	340	1	340
BCR85872.1|GH10	7.20e-202	1	337	1	332
QKX63929.1|GH10	5.10e-187	1	337	1	337
EAA64467.1|GH10	4.24e-183	1	336	1	336
UMZ45343.1|GH10	3.63e-179	7	337	4	333

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1NQ6_A	5.56e-56	31	333	4	302	Crystal Structure of the catalytic domain of xylanase A from Streptomyces halstedii JM8 [Streptomyces halstedii]
1VBR_A	1.13e-55	31	333	6	320	Crystal structure of complex xylanase 10B from Thermotoga maritima with xylobiose [Thermotoga maritima],1VBR_B Crystal structure of complex xylanase 10B from Thermotoga maritima with xylobiose [Thermotoga maritima],1VBU_A Crystal structure of native xylanase 10B from Thermotoga maritima [Thermotoga maritima],1VBU_B Crystal structure of native xylanase 10B from Thermotoga maritima [Thermotoga maritima]
3NIY_A	2.46e-54	31	333	22	336	Crystal structure of native xylanase 10B from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3NIY_B Crystal structure of native xylanase 10B from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3NJ3_A Crystal structure of xylanase 10B from Thermotoga petrophila RKU-1 in complex with xylobiose [Thermotoga petrophila RKU-1],3NJ3_B Crystal structure of xylanase 10B from Thermotoga petrophila RKU-1 in complex with xylobiose [Thermotoga petrophila RKU-1]
1EXP_A	4.51e-50	46	332	18	311	Beta-1,4-Glycanase Cex-Cd [Cellulomonas fimi],1FH7_A Crystal Structure Of The Xylanase Cex With Xylobiose- Derived Inhibitor Deoxynojirimycin [Cellulomonas fimi],1FH8_A Crystal Structure Of The Xylanase Cex With Xylobiose-derived Isofagomine Inhibitor [Cellulomonas fimi],1FH9_A Crystal Structure Of The Xylanase Cex With Xylobiose-derived Lactam Oxime Inhibitor [Cellulomonas fimi],1FHD_A Crystal Structure Of The Xylanase Cex With Xylobiose-derived Imidazole Inhibitor [Cellulomonas fimi],1J01_A Crystal Structure Of The Xylanase Cex With Xylobiose-Derived Inhibitor Isofagomine lactam [Cellulomonas fimi],2EXO_A Crystal Structure Of The Catalytic Domain Of The Beta-1,4- Glycanase Cex From Cellulomonas Fimi [Cellulomonas fimi],2XYL_A Cellulomonas Fimi XylanaseCELLULASE COMPLEXED WITH 2-Deoxy- 2-Fluoro-Xylobiose [Cellulomonas fimi]
3CUF_A	4.88e-50	46	332	18	311	Cellulomonas fimi Xylanase/Cellulase Cex (Cf Xyn10A) in complex with cellobiose-like isofagomine [Cellulomonas fimi],3CUG_A Cellulomonas fimi Xylanase/Cellulase Cex (Cf Xyn10A) in complex with cellotetraose-like isofagomine [Cellulomonas fimi],3CUH_A Cellulomonas fimi Xylanase/Cellulase Cex (Cf Xyn10A) in complex with cellotriose-like isofagomine [Cellulomonas fimi],3CUI_A Cellulomonas fimi Xylanase/Cellulase Cex (Cf Xyn10A) in complex with sulfur substituted beta-1,4 xylotetraose [Cellulomonas fimi],3CUJ_A Cellulomonas fimi Xylanase/Cellulase Cex (Cf Xyn10A) in complex with sulfur substituted beta-1,4 xylopentaose. [Cellulomonas fimi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q00177|XYNC_EMENI	1.88e-48	23	334	13	327	Endo-1,4-beta-xylanase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xlnC PE=1 SV=1
sp|Q60041|XYNB_THENE	3.24e-47	30	328	24	334	Endo-1,4-beta-xylanase B OS=Thermotoga neapolitana OX=2337 GN=xynB PE=3 SV=1
sp|P07986|GUX_CELFI	1.55e-46	46	332	59	352	Exoglucanase/xylanase OS=Cellulomonas fimi OX=1708 GN=cex PE=1 SV=1
sp|P33559|XYNA_ASPKW	1.67e-45	50	333	51	327	Endo-1,4-beta-xylanase A OS=Aspergillus kawachii (strain NBRC 4308) OX=1033177 GN=xynA PE=1 SV=2
sp|P10478|XYNZ_ACET2	2.98e-45	31	336	518	837	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000259	0.999714	CS pos: 24-25. Pr: 0.8464

TMHMM  Annotations     

There is no transmembrane helices in CAP93841:RNA-p1.