CAZyme Information: CAP93625:RNA-p1

Basic Information

• Species: Penicillium rubens
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicillium; Penicillium rubens
• CAZyme ID: CAP93625:RNA-p1
• CAZy Family: GH31
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
453	Pc00c16|CGC12	50097.24	4.7325

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PrubensWisconsin54-1255	14021	500485	1464	12557

• Gene Location: location=Pc00c16:2288193-2289671(-)

Full Sequence      

MPRWLTTLLTFLLLQNALAIEVNPEDETSLKNAAKTVATTMVDYYNARDSKAIPGKFDGT
WWEGGSMFMTLIQYWYLTGDSQFNDAIQEGMYWQKGDDNDFFPSNYSQYLGNDDQVFWGL
AAITAGELNFPERSGEPSWISLAEGVFNGQIPRWDMTACNGGLRWQIWPYQDGYNLKNAI
SNGGLFQLSARLALYTKNATYAEWAEKIWDWSHSTPLLRKTWVIADTTTNAANCKDHGDH
QWTYNYATYIMGAGYMHNYTNGTEGKWLEGVTGLLKTSEQFFPKSGDHQIISDITCEPID
MCDRNQKTFKTYFTSWIGFMSLIVPTNVTAEVMGKFKASAVAAGQQCSGGSDGKHCGIRW
TMKSEWDGTMGLEQQMSVLGVLNAVMVPFTADGPYNADNGGKSKSDPHGGSNPEGSTGPA
PITSGDRVGAGILTAVFVLVWVGAISWMLVGGK

Enzyme Prediction     

No EC number prediction in CAP93625:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	26	389	3e-92	0.9385474860335196

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	4.62e-159	29	379	1	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP93625.1|GH76	0.0	1	453	1	453
QQK39614.1|GH76	3.65e-292	6	453	6	452
CAP99535.1|GH76	5.10e-223	1	452	3	464
QQK44465.1|GH76	2.08e-221	1	452	3	460
BCR95806.1|GH76	3.52e-177	4	452	8	462

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	5.04e-79	25	408	31	423	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AD78|DCW1_CANAL	8.46e-99	19	449	18	451	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCW1 PE=1 SV=1
sp|P36091|DCW1_YEAST	1.21e-94	19	448	21	447	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|Q75DG6|DCW1_ASHGO	2.55e-94	12	450	14	451	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2
sp|Q6FLP9|DCW1_CANGA	3.86e-92	5	448	3	444	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|O74556|YCZ2_SCHPO	1.51e-90	9	408	9	405	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000276	0.999687	CS pos: 19-20. Pr: 0.9816

TMHMM  Annotations     

Start	End
428	450