CAZyme Information: CAP93243:RNA-p1

Basic Information

• Species: Penicillium rubens
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicillium; Penicillium rubens
• CAZyme ID: CAP93243:RNA-p1
• CAZy Family: GH3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
457		52224.91	5.6148

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PrubensWisconsin54-1255	14021	500485	1464	12557

• Gene Location: location=Pc00c16:1325392-1326765(+)

Full Sequence      

MPIGNDLLASMAKRKVARSARVASWDQKGLNEDAFVVLPGQSIVLADLEGPGAITHLWFV
QTCRKIIGPGLIPYSKSGVAMMEIHNALGLNYEVNDPDYYRKVLIKMYWDDSETPNVIAP
IGDFFCLGHSMAANFQSLPFTVSVKPSEEKKFGGAAAFNCYLTMPFNKRARIEIENQNDE
AYFQYFYVDYELYPEPLPADTLYFHAHWRRMNPTNGWAPSRIQTNSLETQVPNLDGKDNY
VILDTEGAGQFIGCNQSVAHFQGTWWGEGDDMIFIDDDTWPPSMHGTGGEDYFTQGWGMQ
KNAYPFCGTIIHEEDVPNYQVSYRWHLTDPVRFNKKIKVTMESGHANHLRDDWSTTAYWY
QTLPGPKLDILPVEKRIPRKPQFPPGDDVPEPHVGSMSSDKQAMIKQRDERMEAFVKDRN
EWLARRAEDSQARARSNVEICKDIRQRFLQSLGQQLQ

Enzyme Prediction     

No EC number prediction in CAP93243:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH172	100	361	4.7e-80	0.9957627118644068

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402651	DUF2961	5.42e-114	101	361	1	234	Protein of unknown function (DUF2961). This family of proteins has no known function.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP93243.1|GH172	0.0	1	457	1	457
CAK39208.1|GH172	0.0	1	453	1	453
QKX59927.1|GH172	8.80e-300	3	452	5	455
UPK94269.1|GH172	9.65e-293	3	452	7	456
QKD59092.1|GH172	7.27e-291	7	452	12	457

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7V1V_A	8.23e-165	7	448	7	446	Chain A, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_B Chain B, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_C Chain C, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_D Chain D, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_E Chain E, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1V_F Chain F, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_A Chain A, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_B Chain B, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_C Chain C, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_D Chain D, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_E Chain E, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1W_F Chain F, Difructose dianhydride I synthase/hydrolase (alphaFFase1) [Bifidobacterium dentium],7V1X_A Chain A, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_B Chain B, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_C Chain C, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_D Chain D, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_E Chain E, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium],7V1X_F Chain F, Difructose dianhydride I synthase/hydrolase [Bifidobacterium dentium]
4KQ7_A	4.83e-51	18	361	20	327	Crystal structure of a DUF2961 family protein (BACUNI_00161) from Bacteroides uniformis ATCC 8492 at 1.62 A resolution [Bacteroides uniformis ATCC 8492],4KQ7_B Crystal structure of a DUF2961 family protein (BACUNI_00161) from Bacteroides uniformis ATCC 8492 at 1.62 A resolution [Bacteroides uniformis ATCC 8492]

Swiss-Prot Hits     

CAP93243:RNA-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000074	0.000000

TMHMM  Annotations     

There is no transmembrane helices in CAP93243:RNA-p1.