CAZyme Information: CAP92553:RNA-p1

Basic Information

• Species: Penicillium rubens
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicillium; Penicillium rubens
• CAZyme ID: CAP92553:RNA-p1
• CAZy Family: GH2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
403	Pc00c13|CGC13	44829.89	6.3950

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PrubensWisconsin54-1255	14021	500485	1464	12557

• Gene Location: location=Pc00c13:3602782-3603993(-)

Full Sequence      

MHLSSPASILLLSALFQTATSTPTSFHLSPNNNISHDYINWRTFHGRGVNLGGWLQQEST
IDTSWWSTYSGGASDEWNLCAQLGSKCGPVLEHRYKTFITTRDIDTLASSGVTVLRIPTS
YAAWVRVPGSQLYSGKQKEHIHRIATYAIEKYDMHIILDIHSLPGGINGLDIGEAVGHWG
WYNNDTALKYSLDAVDSALHFIQFSSGHPQSYTLSPINEPVDNRDFSTFGTPAALSEAGA
SWVLKYLHAVIDRTKKVNPRIPVMCQGSFKPETYWSPHFDAGANIVFDEHHYYFQYSNST
SANLPEFLCQDAKKSAGDGKFPTFVGEWAIEASDNDLGLRGQNLQAGISAFGQFTRGSSY
WTAKFSSNATIKGEGVKGNYWNYEEFVRMGYLDGQVEVPNYCQ

Enzyme Prediction     

EC	3.2.1.149:1	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	95	374	1e-152	0.9964285714285714

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	2.13e-06	90	329	65	322	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP92553.1|GH5_23	7.91e-312	1	403	1	403
QNH86138.1|GH5_23	9.17e-192	20	403	29	416
QMW31304.1|GH5_23	6.00e-170	35	393	27	384
QMW43350.1|GH5_23	6.00e-170	35	393	27	384
BAE61018.1|GH5_23	6.00e-170	35	393	27	384

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6LA0_A	1.06e-171	35	393	8	365	Chain A, Glycoside hydrolase family 5 [Aspergillus oryzae],6LA0_B Chain B, Glycoside hydrolase family 5 [Aspergillus oryzae]
6I1A_A	7.53e-164	38	393	14	370	Crystal structure of rutinosidase from Aspergillus niger [Aspergillus niger],6I1A_B Crystal structure of rutinosidase from Aspergillus niger [Aspergillus niger]
6ZB9_A	1.77e-10	47	230	4	178	Chain A, Exo-beta-1,3-glucanase [uncultured bacterium],6ZB9_B Chain B, Exo-beta-1,3-glucanase [uncultured bacterium]
6ZB8_A	4.18e-10	47	230	4	178	Chain A, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium],6ZB8_B Chain B, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2RAR6|EXGA_ASPNC	1.12e-28	47	398	43	371	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgA PE=3 SV=1
sp|Q9URU6|EXG1_SCHPO	1.30e-22	8	364	9	374	Glucan 1,3-beta-glucosidase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=exg1 PE=2 SV=1
sp|B8N151|EXGA_ASPFN	3.74e-21	47	342	32	313	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=exgA PE=3 SV=1
sp|Q7Z9L3|EXGA_ASPOR	3.74e-21	47	342	32	313	Glucan 1,3-beta-glucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=exgA PE=1 SV=1
sp|Q875R9|EXG_LACK1	4.50e-19	47	385	49	388	Glucan 1,3-beta-glucosidase OS=Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / BCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651) OX=226302 GN=EXG1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000252	0.999754	CS pos: 21-22. Pr: 0.9777

TMHMM  Annotations     

There is no transmembrane helices in CAP92553:RNA-p1.