CAZyme Information: CAP92442:RNA-p1

Basic Information

• Species: Penicillium rubens
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicillium; Penicillium rubens
• CAZyme ID: CAP92442:RNA-p1
• CAZy Family: GH2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
643		69054.07	4.8344

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PrubensWisconsin54-1255	14021	500485	1464	12557

• Gene Location: location=Pc00c13:3331190-3333121(-)

Full Sequence      

MRFGRLLGVAAFSAIVKAIELSGYEYIVVGSGAGGGPLAARLALAGHNTLLIEAGDDQGA
NVNYTVPAFSAAASEDEALAWNFYVKHYADESRQKLDFKTTYETPDGQDYTGLNPPAGST
MKGTLYPRTGTLGGCTAHNALVTVYPHDSDFDYLATLTGDASWSPDNMRKYMERIENNRY
LLPLLKGHGYDGWLSTETAPLDIVLKDPQLLSLLLGGAFSLGNVTNTVFNLGTLLAGDAN
SAGVHRDTTPGYYQVPISSDGSSRNGPREFVTAVRDAKNADGSKKFPLDIRMNCHVTKVT
FDESTPPRATGVEFLDGKYLYSASPRSKTAGKGTPGSATASREVIVSGGVYNSPQILKLS
GIGPGEELQKFGIKVISNLPGVGTNLQDHYEVAVQGHVPKNFTALDGCTFNHGDDPCLDR
WNNPVLGNHGIYSSNGFGAAMLYKSSVTADDSFDVFVFGGPINFRGYFPGYGVNITERHD
WFTWALLKAHPRNTAGTVMLRSADPLDMPDITFNYFDTGSGDYEKDLEAITEAIGVARGA
FDRQVVDVAEVLPGDDVQTDQEIHDYIKDTAWGHHASCTCPIGTDDDPMAVLDSDFQVRG
VSGLRVVDASVYPRIPGTFTALSTFLVAEKAADVILEAAKASH

Enzyme Prediction     

No EC number prediction in CAP92442:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	24	637	8e-92	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	2.08e-74	24	636	6	532	choline dehydrogenase; Validated
225186	BetA	3.15e-73	24	642	8	540	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	3.20e-31	496	631	5	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.19e-18	117	391	11	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	5.59e-16	6	618	34	559	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW33146.1|AA3	0.0	5	636	5	642
QRD84722.1|AA3	0.0	5	636	5	642
QMW45179.1|AA3	0.0	5	636	5	642
UDD58256.1|AA3	0.0	5	636	5	642
EAA61171.1|AA3	0.0	10	636	11	640

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NNE_A	1.48e-40	24	638	14	529	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
3LJP_A	1.48e-40	24	638	14	529	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
2JBV_A	3.74e-40	24	638	14	529	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
6YS1_AAA	1.19e-38	24	635	8	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6YS2_AAA	1.19e-38	24	635	8	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7MF12|BETA_VIBVY	1.04e-49	24	636	5	531	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=betA PE=3 SV=1
sp|Q8D3K2|BETA_VIBVU	9.66e-49	24	636	5	531	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=betA PE=3 SV=1
sp|Q8CMY2|BETA_STAES	2.22e-48	24	635	8	538	Oxygen-dependent choline dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) OX=176280 GN=betA PE=3 SV=1
sp|Q5HL11|BETA_STAEQ	3.04e-48	24	635	8	538	Oxygen-dependent choline dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=betA PE=3 SV=1
sp|Q66D54|BETA_YERPS	6.66e-47	24	635	3	531	Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) OX=273123 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.002452	0.997515	CS pos: 18-19. Pr: 0.9597

TMHMM  Annotations     

There is no transmembrane helices in CAP92442:RNA-p1.