CAZyme Information: CAP91879:RNA-p1

Basic Information

• Species: Penicillium rubens
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicillium; Penicillium rubens
• CAZyme ID: CAP91879:RNA-p1
• CAZy Family: GH16
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
326	Pc00c13|CGC17	31849.57	7.0822

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PrubensWisconsin54-1255	14021	500485	1464	12557

• Gene Location: location=Pc00c13:1964330-1965465(+)

Full Sequence      

MKSTIILTLASIAIAAPTPTIENRQLPGFGSGSGTGTGLDAWKSLMPGLSGSGSGTSTGS
GLDAWKSMMPGLSGSGSGTSTGSGLDAWKSMMPGLSGSGSGSDSSSGSGLSGFGSPIPGR
STSSTGSDSSSGSGFGFPSFGGSGSSTENGVTQNDGCKEYTFIFARGTSEMGNMGSVVGP
PVAKQLKSLTGDKVTVQGVTYPADAAGNGMMGGSGGPTMAKLVKQALSQCPKTKVLLGGY
SQGAMVVHNAANSLDAGQITAAVLFGDPLKAQGVGKLASDKVKEFCNMGDPVCLNGGNVM
AHLAYGSDAETAAKFLIEAAGGSTSS

Enzyme Prediction     

No EC number prediction in CAP91879:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	157	318	2.4e-44	0.9788359788359788

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	1.96e-47	157	319	2	172	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP91879.1|CE5	1.18e-150	1	326	1	326
QQK39777.1|CE5	1.30e-112	1	326	1	280
BAE58644.1|CE5	5.05e-88	142	321	30	209
QRD85183.1|CE5	1.02e-87	136	321	141	326
BCR89623.1|CE5	3.05e-86	146	321	102	277

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4PSC_A	1.50e-35	152	317	74	244	Structure of cutinase from Trichoderma reesei in its native form. [Trichoderma reesei QM6a],4PSD_A Structure of Trichoderma reesei cutinase native form. [Trichoderma reesei QM6a],4PSE_A Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a],4PSE_B Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a]
3GBS_A	1.52e-25	157	321	21	197	Crystal structure of Aspergillus oryzae cutinase [Aspergillus oryzae]
3QPD_A	8.69e-25	157	317	12	184	Structure of Aspergillus oryzae cutinase expressed in Pichia pastoris, crystallized in the presence of Paraoxon [Aspergillus oryzae]
1CUZ_A	1.66e-24	157	318	31	205	Chain A, CUTINASE [Fusarium vanettenii]
1CUH_A	1.20e-23	157	318	31	205	Chain A, CUTINASE [Fusarium vanettenii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|C8VJF5|CUTI4_EMENI	1.18e-79	144	321	47	222	Cutinase 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cut4 PE=2 SV=1
sp|Q00298|CUTI_BOTFU	2.19e-38	157	321	31	201	Cutinase OS=Botryotinia fuckeliana OX=40559 GN=cutA PE=1 SV=1
sp|A8QPD8|CUTI1_TRIHA	2.96e-37	152	316	74	243	Cutinase cut1 OS=Trichoderma harzianum OX=5544 GN=cut1 PE=1 SV=1
sp|Q8TGB8|CUTI_MONFR	1.77e-36	143	321	17	200	Cutinase OS=Monilinia fructicola OX=38448 GN=CUT1 PE=2 SV=1
sp|Q8X1P1|CUTI_BLUHO	4.88e-35	145	318	56	234	Cutinase OS=Blumeria hordei OX=2867405 GN=CUT1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000244	0.999727	CS pos: 24-25. Pr: 0.9564

TMHMM  Annotations     

There is no transmembrane helices in CAP91879:RNA-p1.