CAZyme Information: CAP91236:RNA-p1

Basic Information

• Species: Penicillium rubens
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicillium; Penicillium rubens
• CAZyme ID: CAP91236:RNA-p1
• CAZy Family: GH15|CBM20
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
643	Pc00c13|CGC1	70121.56	5.3087

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PrubensWisconsin54-1255	14021	500485	1464	12557

• Gene Location: location=Pc00c13:390574-392731(-)

Full Sequence      

MAQLYWPSVVLILWSLFSLSTADTCWRETTCSGPTNTAFSGPWEKNIYAPASRTVRPAST
LSELKTNAVTDPAHPYKATLYGNGSIIVFDFGIEVGGIVHLDYTSTGSGALGLAFTEAKN
WIGEWSDSSSALYHDGALYANISSTGKGTYVMPDKYLRGGFRYLTVFLLTDYSTSVQIED
LTLELAFKPTWANLRAYQGYFHCSDELLNRIWYSGAYTLQTNEVSVDTGRVTKGVTSGWV
NNGTLGPGDTIIVDGAKRDRAVWPGDMGIAVPSAFVSLGDLESVKSALQIMYNTQNKTTG
AFDESGPPLSQKGSDTYHMWSMIGTYKYVLYTNDTDFLFKNWASYQHAMEYIYGKTGASL
ALWAGDSTNLSSIWSSQAANLKKAINTYCWDESYGAFKDNATNTSLHPQDANSMAIMFGV
VNEERTASISEKLLKNWTPIGAVAPELPENIASFISSFEIQSHFIAHKPARALDLIRRSW
GWYINNPNGTESTVIEGYLQNGTFGYRMDRGYGYDPSYVSHAHGWSSGPTSALTEYVVGL
SVVSPLGLTWKIAPQFGDLEFAEAGFVTSLGKFQASWILNSSGYVLTFSVPKGTDGNVTL
PYVTASKKPSITIDGDQLMRGVAYADGAATVEVTGGSHKVVVT

Enzyme Prediction     

EC	3.2.1.174:2	3.2.1.174:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	356	600	2.1e-42	0.44642857142857145
GH78	86	363	2.6e-40	0.4742063492063492

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
379972	Bac_rhamnosid_C	3.99e-06	543	601	2	64	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
407469	Bac_rhamnosid6H	0.002	199	435	4	253	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP91236.1|GH78	0.0	1	643	1	643
BAU45349.1|GH78|3.2.1.174	0.0	1	643	1	680
QQK41592.1|GH78	0.0	1	642	1	679
UCK57529.1|GH78	8.33e-318	1	643	4	686
CAK43282.1|GH78	5.56e-317	6	631	3	623

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	1.08e-10	71	571	179	670	Crystal structure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

CAP91236:RNA-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000193	0.999770	CS pos: 22-23. Pr: 0.9800

TMHMM  Annotations     

There is no transmembrane helices in CAP91236:RNA-p1.