CAZyme Information: CAP86666:RNA-p1

Basic Information

• Species: Penicillium rubens
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicillium; Penicillium rubens
• CAZyme ID: CAP86666:RNA-p1
• CAZy Family: GH132
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
322		34151.03	4.8778

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PrubensWisconsin54-1255	14021	500485	1464	12557

• Gene Location: location=Pc00c20:3097864-3098940(+)

Full Sequence      

MYPYNFLLTALSLGTAVLAAPAELVTRTARTSAPLGCLTVGSNGKYSTIGDALTALGSSS
APACIYVASGTYEEQITINYAGALTLYGETADTETYKENTVTITHTISSPQAGSLDKSAT
VNVVADGFKMHNINVVNGFRKGAQAVALVANADKLSFYACQFSGYQDTLYAKAGKQYYAN
SKVEGAVDYIFGAASAWFNNCDIVSNGPGAITASSRQTTTDTTWYAFDDCTVKASSSAIE
DGTVFLGRPWRVLARVIFQNSSLRSVVNPKGWTTMADGATPLYYEYNNSGAGSDTSERQF
ETPISAAIAKQTVLGSDYATWI

Enzyme Prediction     

EC	3.1.1.11:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	42	299	1.4e-79	0.8958333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395871	Pectinesterase	6.34e-56	43	298	9	271	Pectinesterase.
178372	PLN02773	2.10e-45	32	298	1	275	pectinesterase
215357	PLN02665	7.12e-45	44	298	78	333	pectinesterase family protein
178051	PLN02432	1.88e-44	43	298	20	265	putative pectinesterase
178606	PLN03043	5.14e-42	38	298	225	497	Probable pectinesterase/pectinesterase inhibitor; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP86666.1|CE8	2.31e-229	1	322	1	322
QQK45298.1|CE8	3.95e-182	1	322	1	322
AKH40276.1|CE8	6.64e-163	7	322	6	321
EHA20167.1|CE8	2.25e-159	5	322	4	323
CAK47976.1|CE8	7.48e-158	6	322	5	323

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	3.86e-159	30	322	3	295	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	3.86e-159	30	322	3	295	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1XG2_A	6.44e-31	44	298	13	274	Chain A, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	3.46e-27	43	298	16	278	Pectin methylesterase from Carrot [Daucus carota]
2NSP_A	1.59e-19	42	315	13	335	Chain A, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QK82|PMEA_ASPNC	1.33e-158	6	322	5	323	Probable pectinesterase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pmeA PE=3 SV=1
sp|B8NPS7|PMEA_ASPFN	2.51e-153	18	322	15	320	Probable pectinesterase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pmeA PE=3 SV=1
sp|Q2UBD9|PMEA_ASPOR	3.57e-153	8	322	10	320	Probable pectinesterase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pmeA PE=3 SV=1
sp|A1DBT4|PMEA_NEOFI	2.14e-147	1	322	1	320	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1
sp|Q4WBT5|PMEA_ASPFU	5.00e-146	1	322	1	320	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000256	0.999710	CS pos: 27-28. Pr: 0.7616

TMHMM  Annotations     

There is no transmembrane helices in CAP86666:RNA-p1.