CAZyme Information: CAP86500:RNA-p1

Basic Information

• Species: Penicillium rubens
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicillium; Penicillium rubens
• CAZyme ID: CAP86500:RNA-p1
• CAZy Family: GH13
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
360	Pc00c20|CGC15	41877.05	7.5273

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PrubensWisconsin54-1255	14021	500485	1464	12557

• Gene Location: location=Pc00c20:2695918-2697163(-)

Full Sequence      

MRRGLFIFLLVNLIIISVLVRSVSTLLSLLVEDAAADAIHRAELPSPNSSLIEQRPQIIP
KIIHQTYKNETIPEVWVEAQQSCIDLHPDYEYILWTNEKSREFIAAEYPWFLDTFDGYSY
PIQRADSIRYFILAHFGGTYIDLDDGCNRRLDPLLAYPAWVRRTAPTGISNDAMGSVPQH
PFFLRTIEVLQQYDRHWLLPYITVMYSTGPLFLSVVWKEYMRDGPSDAGRVRILMQDEYN
RFSWSFFTHHRGNSWHGKDAHLIFWMGQHWLFLTVCGFLVAGVVGFCLWWTYGRVMLLGA
KYRYRYSKVPSIISPSRLSMSPTRRSRLSVPTILRRVSFKEDEEAGGVTETSYELGRRDD

Enzyme Prediction     

No EC number prediction in CAP86500:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	76	155	1.4e-21	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	5.28e-76	59	286	82	311	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	4.61e-26	73	157	1	89	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP86500.1|GT32	3.78e-270	1	360	1	360
QQK45416.1|GT32	3.30e-257	1	360	1	359
CAK42232.1|GT32	2.79e-233	1	360	1	359
BCS14035.1|GT32	3.96e-233	1	360	1	359
BCS02358.1|GT32	3.96e-233	1	360	1	359

PDB Hits     

CAP86500:RNA-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P38287|CSH1_YEAST	1.40e-103	1	338	1	354	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|P33300|SUR1_YEAST	2.40e-103	26	279	26	275	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	7.92e-90	37	306	56	327	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|Q10323|IMT3_SCHPO	2.02e-87	48	317	46	317	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|O14084|IMT1_SCHPO	1.36e-52	59	288	64	295	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.359204	0.640787	CS pos: 25-26. Pr: 0.3149

TMHMM  Annotations     

Start	End
5	27
270	292