CAZyme Information: CAP86287:RNA-p1

Basic Information

• Species: Penicillium rubens
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicillium; Penicillium rubens
• CAZyme ID: CAP86287:RNA-p1
• CAZy Family: GH12
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
981		107897.42	4.6935

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PrubensWisconsin54-1255	14021	500485	1464	12557

• Gene Location: location=Pc00c20:2221650-2224799(-)

Full Sequence      

MGIPRSWGGILRGLSAFCAIAQAQTSSPSPTSSHSAQFTVPAEANIAPAVIPNIKDPQAV
DAQTVCPGYTASNVQQTASGFTASLSLAGDACNVYGTDIEALSLTVEYQRADRLHVAIVP
THIGAENATQYLIPQGYLAEPEVEEPNVVSDLEFSWTNDPSFGFEVTRKSTKDVLFSTKG
TRIVFENQFVEFKSALPKNYNLYGLGESVHGFRLGNNYTKTYYAADAGATVDINVYGAHP
FFLETRYFTEDADGNLKLVESYEATAKSNYTSLSHGVFSRNAHGQDILMQEDSITYRAIG
GSVDLYFFPGPSQPEVTKSYLTTVGLPAMQQYWTFGFHQCRWGYTSWAELEDVVNNHTHF
DIPLETIWTDIDWMVRYRDFENNPVGFDDESSKGFIQRLHDGGRHYVPIIDSAIYIPNPS
NPDDAYPVFERGNDTGAFLTNPDGSLYVGAVWPGYTVFPDWLAEGTEQWWIDEMVRYYQI
TGYDGAWIDMSEISSFCVGSCGSNNLTLQPVHVPFALPGEPANPVLIYPEGFNKTNATEA
ASASAARASWSSAYPTSSATASTSYVRTTPTPDVRDVNYPPYAINNVKGALAVGAISPNA
THADGTLEYDVHNLWGHGILKATYNALSAISPDARPFILGRSTFAGSGSYAAHWGGDNWS
NWPSMILSIPQALSMSLLGIPMFGVDTCGFADNTDMELCNRWMQLSAFFPFYRNHNILGA
ISQEAYRWSSVIDASKAAMAIRYQLLPYMYTLFYHAHKKGETVMRALAWEFPRNPSLANA
DRQFMLGPSILVIPVLEQGATSVNGVFPGLIEGEEVWYDWYNNTAVPVPAQANTTINAPL
GHIPVYARGGSVFPLQQSALTTRDARNSPWDILVALDKDGSATGNLYLDDGVSVTPNATL
HAEFKVENRKLETLIEHGGWVEENNLRNVTIWGVEKANTPIKFNGKAVPPKNVHFDGDKN
TLVVSGFDVSAWAGKRWSLEW

Enzyme Prediction     

No EC number prediction in CAP86287:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	306	852	9e-148	0.9929742388758782

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395838	Glyco_hydro_31	0.0	306	852	1	441	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
269888	GH31_MGAM_SI_GAA	0.0	325	757	1	367	maltase-glucoamylase, sucrase-isomaltase, lysosomal acid alpha-glucosidase. This subgroup includes the following three closely related glycosyl hydrolase family 31 (GH31) enzymes: maltase-glucoamylase (MGAM), sucrase-isomaltase (SI), and lysosomal acid alpha-glucosidase (GAA), also known as acid-maltase. MGAM is one of the two enzymes responsible for catalyzing the last glucose-releasing step in starch digestion. SI is implicated in the digestion of dietary starch and major disaccharides such as sucrose and isomaltose, while GAA degrades glycogen in the lysosome, cleaving both alpha-1,4 and alpha-1,6 glucosidic linkages. MGAM and SI are anchored to small-intestinal brush-border epithelial cells. The absence of SI from the brush border membrane or its malfunction is associated with malabsorption disorders such as congenital sucrase-isomaltase deficiency (CSID). The domain architectures of MGAM and SI include two tandem GH31 catalytic domains, an N-terminal domain found near the membrane-bound end, and a C-terminal luminal domain. Both of the tandem GH31 domains of MGAM and SI are included in this family. The domain architecture of GAA includes an N-terminal TFF (trefoil factor family) domain in addition to the GH31 catalytic domain. Deficient GAA expression causes Pompe disease, an autosomal recessive genetic disorder also known as glycogen storage disease type II (GSDII).
269889	GH31_GANC_GANAB_alpha	1.41e-123	325	893	1	467	neutral alpha-glucosidase C, neutral alpha-glucosidase AB. This subgroup includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB). Initially distinguished on the basis of differences in electrophoretic mobility in starch gel, GANC and GANAB have been shown to have other differences, including those of substrate specificity. GANC and GANAB are key enzymes in glycogen metabolism that hydrolyze terminal, non-reducing 1,4-linked alpha-D-glucose residues from glycogen in the endoplasmic reticulum. The GANC/GANAB family includes the alpha-glucosidase II (ModA) from Dictyostelium discoideum as well as the alpha-glucosidase II (GLS2, or ROT2 - Reversal of TOR2 lethality protein 2) from Saccharomyces cerevisiae.
224418	YicI	2.35e-122	61	948	22	760	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
269890	GH31_glucosidase_II_MalA	1.17e-100	325	760	1	339	Alpha-glucosidase II-like. Alpha-glucosidase II (alpha-D-glucoside glucohydrolase) is a glycosyl hydrolase family 31 (GH31) enzyme, found in bacteria and plants, which has exo-alpha-1,4-glucosidase and oligo-1,6-glucosidase activities. Alpha-glucosidase II has been characterized in Bacillus thermoamyloliquefaciens where it forms a homohexamer. This subgroup also includes the MalA alpha-glucosidase from Sulfolobus solfataricus and the AglA alpha-glucosidase from Picrophilus torridus. MalA is part of the carbohydrate-metabolizing machinery that allows this organism to utilize carbohydrates, such as maltose, as the sole carbon and energy source.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP86287.1|GH31	0.0	1	981	1	981
BCR90073.1|GH31	0.0	9	981	11	983
QSS53893.1|GH31	0.0	38	981	43	999
QSS75516.1|GH31	0.0	38	981	43	999
CCD50290.1|GH31	0.0	21	981	22	996

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W37_A	2.53e-159	68	894	44	801	Sugar beet alpha-glucosidase with acarbose [Beta vulgaris],3W38_A Sugar beet alpha-glucosidase [Beta vulgaris],3WEL_A Sugar beet alpha-glucosidase with acarviosyl-maltotriose [Beta vulgaris],3WEM_A Sugar beet alpha-glucosidase with acarviosyl-maltotetraose [Beta vulgaris],3WEN_A Sugar beet alpha-glucosidase with acarviosyl-maltopentaose [Beta vulgaris],3WEO_A Sugar beet alpha-glucosidase with acarviosyl-maltohexaose [Beta vulgaris]
5NN3_A	2.22e-145	67	981	54	871	Crystal structure of human lysosomal acid-alpha-glucosidase, GAA [Homo sapiens],5NN5_A Crystal structure of human lysosomal acid-alpha-glucosidase, GAA, in complex with 1-deoxynojirimycin [Homo sapiens],5NN6_A Crystal structure of human lysosomal acid-alpha-glucosidase, GAA, in complex with N-hydroxyethyl-1-deoxynojirimycin [Homo sapiens],5NN8_A Crystal structure of human lysosomal acid-alpha-glucosidase, GAA, in complex with acarbose [Homo sapiens]
5NN4_A	2.22e-145	67	981	54	871	Crystal structure of human lysosomal acid-alpha-glucosidase, GAA, in complex with N-acetyl-cysteine [Homo sapiens]
5KZW_A	2.34e-145	67	981	56	873	Crystal structure of human GAA [Homo sapiens],5KZX_A Crystal structure of human GAA [Homo sapiens]
2QLY_A	9.21e-143	69	981	53	868	Crystral Structure of the N-terminal Subunit of Human Maltase-Glucoamylase [Homo sapiens],2QMJ_A Crystral Structure of the N-terminal Subunit of Human Maltase-Glucoamylase in Complex with Acarbose [Homo sapiens],3CTT_A Crystal complex of N-terminal Human Maltase-Glucoamylase with Casuarine [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P56526|AGLU_ASPNG	0.0	29	981	26	985	Alpha-glucosidase OS=Aspergillus niger OX=5061 GN=aglA PE=1 SV=1
sp|Q12558|AGLU_ASPOR	0.0	18	981	18	985	Alpha-glucosidase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=agdA PE=2 SV=1
sp|O74254|AMYG_CANAL	1.21e-286	30	948	22	915	Glucoamylase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GAM1 PE=1 SV=3
sp|P22861|AMYG_SCHOC	3.75e-272	37	968	42	942	Glucoamylase 1 OS=Schwanniomyces occidentalis OX=27300 GN=GAM1 PE=1 SV=1
sp|Q9URX4|YFZB_SCHPO	2.36e-263	38	981	51	991	Uncharacterized family 31 glucosidase C1039.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1039.11c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.007398	0.992577	CS pos: 23-24. Pr: 0.7389

TMHMM  Annotations     

There is no transmembrane helices in CAP86287:RNA-p1.