CAZyme Information: CAP85828:RNA-p1

Basic Information

• Species: Penicillium rubens
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicillium; Penicillium rubens
• CAZyme ID: CAP85828:RNA-p1
• CAZy Family: CE8
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
544		58321.18	7.9239

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PrubensWisconsin54-1255	14021	500485	1464	12557

• Gene Location: location=Pc00c20:1132740-1134429(-)

Full Sequence      

MRIFQAGPLAIALSVFTGAASASAFQNHTYDYIVVGGGPSGIISAEKFAQAGKKVLLLER
GVGPTVATGNNETLTWDHSLTPIDLPGLSANIGALDVWNQYMCTDTAGNAACVLGGGVTV
NYMVFVHPPARDFDDKWPEGWKWKDVESAADRLYKRNPGTTLPSADGKRYDQGLYNVLSK
FLSGLGWKSVDMIAEPNEKHQIYSYPSWNVQDQMRAGPVRTYLPAAAKLDNFHLALRTKV
IRLVRSGSQVTGVEVQTPSGRSQIITVAPHGRVVLAAGALSTPRLLWNSGIGGKAQIETA
KKSGVAVPPKAQWIDLPVGVGLKDHPIFPITFNTNASFGLVDYEGVLNGTDSRDISLYRK
HSGVLTQGKHRLIFFTSEEIDGHTQYYQGSCAPTDEGVVTMTTYMTHGLTSSGVLGLDAS
GNTVIEKLPYLQTAADRKAARTFIQKMVKDITAPSTGFELETHTNVSAILKAQTPGTHYV
SSAKMGTDDGRKNGTSVVDTNAKVYGVDNLFIVDASIHPDLPTGNIQTAVMVVAEAAAVK
ILSN

Enzyme Prediction     

No EC number prediction in CAP85828:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	19	543	5.4e-198	0.9854014598540146

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	4.67e-38	23	527	1	519	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	3.10e-34	31	523	2	468	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
366272	GMC_oxred_N	1.38e-22	99	327	15	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
235000	PRK02106	5.65e-19	27	526	3	516	choline dehydrogenase; Validated
398739	GMC_oxred_C	3.35e-17	393	527	1	133	GMC oxidoreductase. This domain found associated with pfam00732.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP85828.1|AA3_1	0.0	1	544	1	544
QQK48042.1|AA3_1	0.0	1	542	1	542
UDD61147.1|AA3_1	1.16e-294	1	543	1	538
QMW45398.1|AA3_1	6.38e-292	1	543	1	538
QRD84961.1|AA3_1	6.38e-292	1	543	1	538

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QI7_A	1.11e-99	15	543	215	765	Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A],4QI7_B Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A]
4QI4_A	5.66e-93	29	543	7	544	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides],4QI5_A Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]
1NAA_A	4.13e-91	30	543	3	536	Chain A, Cellobiose dehydrogenase [Phanerodontia chrysosporium],1NAA_B Chain B, Cellobiose dehydrogenase [Phanerodontia chrysosporium]
1KDG_A	4.72e-91	30	543	8	541	Chain A, cellobiose dehydrogenase [Phanerodontia chrysosporium],1KDG_B Chain B, cellobiose dehydrogenase [Phanerodontia chrysosporium]
4QI6_A	8.84e-91	29	543	229	766	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q01738|CDH_PHACH	1.79e-88	8	543	217	768	Cellobiose dehydrogenase OS=Phanerodontia chrysosporium OX=2822231 GN=CDH-1 PE=1 SV=1
sp|Q5B8A1|PKFF_EMENI	4.78e-24	25	538	36	604	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|Q8D3K2|BETA_VIBVU	5.36e-21	26	542	2	531	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=betA PE=3 SV=1
sp|Q6LGH5|BETA_PHOPR	5.52e-21	26	544	1	533	Oxygen-dependent choline dehydrogenase OS=Photobacterium profundum (strain SS9) OX=298386 GN=betA PE=3 SV=1
sp|Q7MF12|BETA_VIBVY	2.25e-20	26	542	2	531	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000612	0.999353	CS pos: 22-23. Pr: 0.9853

TMHMM  Annotations     

There is no transmembrane helices in CAP85828:RNA-p1.