CAZyme Information: CAP85774:RNA-p1

Basic Information

• Species: Penicillium rubens
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicillium; Penicillium rubens
• CAZyme ID: CAP85774:RNA-p1
• CAZy Family: CE5
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
320	Pc00c20|CGC18	36870.83	6.4270

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PrubensWisconsin54-1255	14021	500485	1464	12557

• Gene Location: location=Pc00c20:1009315-1010277(+)

Full Sequence      

MVPHRNWAFTPYSRKVIAIVTCLALFLWVATPLGCYGSTDDSKPPRYAFATVLMTENDTE
FPDIEAPYFQAARLLTFQLLRNPRTRNRIDNVPFLILVTPDIPQRHRDALSREGATVVPM
DNLNLDDGSSQRWNAVLTKLNLWKLVEYDKIVFLNVNSVIFRPIYDIFEDPATNMRATVT
PTAKMPKNYMIAAPHDSRTNSNAQLVLGQESYQKDHMNDGFFILHPSKDLYNYYVSLHHI
RDKDESVHPEQDVLDYAHRADGPMPWQNLGPGWNLKDASRSDYERGLESINHKWWRPIAD
DFVGGRIAMAMDEMTAYLNH

Enzyme Prediction     

No EC number prediction in CAP85774:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	67	281	3.5e-25	0.7626459143968871

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133018	GT8_Glycogenin	7.16e-22	47	254	1	163	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
227884	Gnt1	7.76e-12	68	302	83	343	Alpha-N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
215090	PLN00176	5.51e-05	93	171	54	136	galactinol synthase
133064	GT8_GNT1	4.14e-04	95	171	33	115	GNT1 is a fungal enzyme that belongs to the GT 8 family. N-acetylglucosaminyltransferase is a fungal enzyme that catalyzes the addition of N-acetyl-D-glucosamine to mannotetraose side chains by an alpha 1-2 linkage during the synthesis of mannan. The N-acetyl-D-glucosamine moiety in mannan plays a role in the attachment of mannan to asparagine residues in proteins. The mannotetraose and its N-acetyl-D-glucosamine derivative side chains of mannan are the principle immunochemical determinants on the cell surface. N-acetylglucosaminyltransferase is a member of glycosyltransferase family 8, which are, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed, retaining glycosyltransferases.
132996	Glyco_transf_8	0.001	86	254	25	193	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP85774.1|GT8	1.42e-247	1	320	1	320
QMW32290.1|GT8	2.18e-79	38	320	73	368
QRD83739.1|GT8	2.18e-79	38	320	73	368
UDD57256.1|GT8	6.14e-79	38	320	73	368
BAE62267.1|GT8	9.78e-78	42	320	77	368

PDB Hits     

CAP85774:RNA-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O43061|MU136_SCHPO	7.53e-12	36	297	46	338	Meiotically up-regulated gene 136 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug136 PE=1 SV=1
sp|O43062|YGT9_SCHPO	1.14e-09	38	295	68	345	Uncharacterized protein C4C3.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC4C3.09 PE=4 SV=1
sp|Q09680|YA0C_SCHPO	1.50e-09	43	302	65	347	Uncharacterized protein C5H10.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC5H10.12c PE=4 SV=1
sp|Q5UNW1|YR707_MIMIV	1.09e-07	47	291	4	259	Uncharacterized protein R707 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_R707 PE=4 SV=1
sp|Q947G8|GOLS1_SOLLC	4.26e-07	93	171	51	134	Galactinol synthase 1 OS=Solanum lycopersicum OX=4081 GN=GOLS1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.944679	0.055333

TMHMM  Annotations     

Start	End
15	37