CAZyme Information: CAP85554:RNA-p1

Basic Information

• Species: Penicillium rubens
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicillium; Penicillium rubens
• CAZyme ID: CAP85554:RNA-p1
• CAZy Family: CE4
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
441	Pc00c20|CGC15	48359.04	4.5946

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PrubensWisconsin54-1255	14021	500485	1464	12557

• Gene Location: location=Pc00c20:510419-511938(+)

Full Sequence      

MFKRLALGLLAAQSVAAMRFAMYHTTALPGQEKTEGIDYAIMSFAASKLFNSDSPAEYKP
FESPETMRKRFSPDTKLMVAIGGWGDTAGFSEGAKDEASRTRYAKNVASMLDAHGFDGVD
IDWEYPGGNGQDYRQVPNEEKVDEIETYPLFLEALRKELGDKIISIAVPGRKQDLIAYTK
EQGPKIWKSVDMVNVMSYDLTNRRDNVTNHASGVQGSLDTINEYLAIGADPEKLNLGFAY
YAKWFTTNADSDCEENPLGCELAKLENDDGSDNGKSGALTFEASTVAAPPKDLKDSTDGL
CGFGAKTKCPSGQCCSSSGYCGTTDEFCQAGCLSDYGTCKGISITDSWRKAQKDGKTDEK
GGGQYYFDSENNLFWTWDTPEMIARKFKEIVAEKKLGGVMAWSLGEDTYKFEHLEAMQKG
IKSQSNSPKVEEPPVAERGCA

Enzyme Prediction     

EC	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	38	412	1e-54	0.8817567567567568

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395573	Glyco_hydro_18	1.20e-76	20	407	6	307	Glycosyl hydrolases family 18.
214753	Glyco_18	5.30e-52	69	407	61	334	Glyco_18 domain.
119365	GH18_chitinase	2.57e-41	73	407	83	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
119349	GH18_chitinase-like	6.00e-40	20	200	1	178	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
119351	GH18_chitolectin_chitotriosidase	2.74e-35	69	404	65	338	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP85554.1|CBM18|GH18	0.0	1	441	1	441
QQK48241.1|CBM18|GH18	9.42e-278	1	427	1	431
QRD94346.1|CBM18|GH18	6.15e-220	2	425	3	431
QMW33929.1|CBM18|GH18	6.15e-220	2	425	3	431
QMW45983.1|CBM18|GH18	6.15e-220	2	425	3	431

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JM7_A	2.53e-17	66	245	67	254	Crystal structure of Ostrinia furnacalis Group IV chitinase [Ostrinia furnacalis],6JMB_A Chain A, ofchtiv-allosamidin [Ostrinia furnacalis]
6TSB_AAA	5.02e-17	73	243	89	263	Chain AAA, Peroxiredoxin [Clostridioides difficile 630]
6T9M_AAA	5.83e-17	73	243	108	282	Chain AAA, Peroxiredoxin [Clostridioides difficile 630]
1H0G_A	1.35e-16	66	419	79	420	Complex of a chitinase with the natural product cyclopentapeptide argadin from Clonostachys [Serratia marcescens],1H0G_B Complex of a chitinase with the natural product cyclopentapeptide argadin from Clonostachys [Serratia marcescens],1H0I_A Complex of a chitinase with the natural product cyclopentapeptide argifin from Gliocladium [Serratia marcescens],1H0I_B Complex of a chitinase with the natural product cyclopentapeptide argifin from Gliocladium [Serratia marcescens]
6JK9_A	5.65e-16	66	419	77	418	Crystal structure of Serratia marcescens Chitinase B complexed with compound 2-8-14 [Serratia marcescens],6JK9_B Crystal structure of Serratia marcescens Chitinase B complexed with compound 2-8-14 [Serratia marcescens],7C34_A Crystal structure of Serratia marcescens Chitinase B complexed with Berberine [Serratia marcescens],7C34_B Crystal structure of Serratia marcescens Chitinase B complexed with Berberine [Serratia marcescens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32470|CHI1_APHAL	1.18e-16	28	308	59	349	Chitinase 1 OS=Aphanocladium album OX=12942 GN=CHI1 PE=1 SV=2
sp|E9ERT9|CHI1_METRA	9.19e-16	69	245	117	298	Endochitinase 1 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) OX=655844 GN=chit1 PE=3 SV=1
sp|Q9W092|CHIT2_DROME	3.74e-15	69	428	112	420	Probable chitinase 2 OS=Drosophila melanogaster OX=7227 GN=Cht2 PE=1 SV=1
sp|P11797|CHIB_SERMA	1.64e-14	66	419	79	420	Chitinase B OS=Serratia marcescens OX=615 GN=chiB PE=1 SV=1
sp|P20533|CHIA1_NIACI	5.27e-14	69	243	149	340	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.033880	0.966075	CS pos: 17-18. Pr: 0.9289

TMHMM  Annotations     

There is no transmembrane helices in CAP85554:RNA-p1.