CAZyme Information: CAP83037:RNA-p1

Basic Information

• Species: Penicillium rubens
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Penicillium; Penicillium rubens
• CAZyme ID: CAP83037:RNA-p1
• CAZy Family: CE12
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
623		68768.96	5.4748

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PrubensWisconsin54-1255	14021	500485	1464	12557

• Gene Location: location=Pc00c15:359789-362387(+)

Full Sequence      

MSVCRTSYAIWLALCYFVSHSNAILRTYNLTVHNDVKAPDGVSREVFLINGQLPGPLIEA
DEGDDLEIFVKNDLPVDTSLHWHGILQRGSPDMDGVPGVTQYPIPPGGNFTYRFSIKDQY
GFFWYHSHVRAYYNDGIRGPLLIRPSPQRLRPFEKLAHSPHERDIILQTERDATSILLSD
WTHELSDTIYARYFETGAFPNCVDSILANGFGRVECLPDTSMSAMPMSATMTMSDMSPSM
TSLSPRGCMPPMMFRQGYNVSSLPPETCTNTSSSLLTIPADHTSGWLALNLVNSGAVSKL
HVSLDAHSMFVYAADGLYVEIQEVKVLEIEIGQRYSVMIRLDQKPGNYYLRFASYPNGDM
QQVLEGQAIVSYNMSMMSSRTPMNVTVDPSTIWMLTNGSAKPDTSVLNPQLLSPFAPVNP
PSAPADQTYTFTINQTDIVTWVVNDASYSEPKIPIIQGNVSDGWQANTTIHVPSNSTIDI
IMRIANDSMDTMSHPMHLHGHTFWVLGSGTGSFPYDSATDAPESLINLRNPPYRDTTNLP
PSGWAVIRYVTDNPGAWIFHCHIQWHMVSGMALVLVEGPDQFPALIGQSNNGTPPATSAA
PMRRISSRQTALTAAAASLMMLG

Enzyme Prediction     

No EC number prediction in CAP83037:RNA-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA1	42	572	1.6e-97	0.9804469273743017

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
274555	ascorbase	3.58e-80	26	581	2	527	L-ascorbate oxidase, plant type. Members of this protein family are the copper-containing enzyme L-ascorbate oxidase (EC 1.10.3.3), also called ascorbase. This family is found in flowering plants, and shows greater sequence similarity to a family of laccases (EC 1.10.3.2) from plants than to other known ascorbate oxidases.
177843	PLN02191	2.10e-75	11	581	7	550	L-ascorbate oxidase
215324	PLN02604	3.59e-70	8	581	1	550	oxidoreductase
259919	CuRO_1_Abr2_like	5.94e-64	28	144	1	117	The first cupredoxin domain of a group of fungal Laccases similar to Abr2 from Aspergillus fumigatus. Abr2 is involved in conidial pigment biosynthesis in Aspergillus fumigatus. Laccase is a blue multi-copper enzyme that catalyzes the oxidation of a variety aromatic - notably phenolic and inorganic substances coupled to the reduction of molecular oxygen to water. Laccase has been implicated in a wide spectrum of biological activities and, in particular, plays a key role in morphogenesis, development and lignin metabolism in fungi and plants. Like other related multicopper oxidases (MCOs), laccase is composed of three cupredoxin domains that include one mononuclear and one trinuclear copper center. The copper ions are bound in several sites: Type 1, Type 2, and/or Type 3. The ensemble of types 2 and 3 copper is called a trinuclear cluster. MCOs oxidize their substrate by accepting electrons at a mononuclear copper center and transferring them to the active site trinuclear copper center. The cupredoxin domain 1 of 3-domain MCOs contains part the trinuclear copper binding site, which is located at the interface of domains 1 and 3.
225043	SufI	2.91e-56	40	579	48	450	Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) [Cell cycle control, cell division, chromosome partitioning, Inorganic ion transport and metabolism, Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLI72976.1|AA1	1.52e-285	1	600	7	666
QPG98040.1|AA1	1.10e-269	10	586	10	642
QOD95012.1|AA1	2.19e-261	22	596	23	653
ATY66532.1|AA1	2.08e-250	16	595	7	638
UNI13709.1|AA1	2.02e-247	21	583	21	631

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3V9E_A	2.33e-61	24	577	66	542	Structure of the L499M mutant of the laccase from B.aclada [Botrytis aclada]
3SQR_A	6.21e-61	24	577	66	542	Crystal structure of laccase from Botrytis aclada at 1.67 A resolution [Botrytis aclada],4X4K_A Structure of laccase from Botrytis aclada with full copper content [Botrytis aclada]
5EHF_A	1.08e-60	29	577	7	467	Laccase from Antrodiella faginea [Antrodiella faginea]
3X1B_A	1.82e-59	29	584	28	498	Crystal structure of laccase from Lentinus sp. at 1.8 A resolution [Lentinus],3X1B_B Crystal structure of laccase from Lentinus sp. at 1.8 A resolution [Lentinus]
1AOZ_A	3.46e-59	25	581	3	527	Refined Crystal Structure Of Ascorbate Oxidase At 1.9 Angstroms Resolution [Cucurbita pepo var. melopepo],1AOZ_B Refined Crystal Structure Of Ascorbate Oxidase At 1.9 Angstroms Resolution [Cucurbita pepo var. melopepo],1ASO_A X-Ray Structures And Mechanistic Implications Of Three Functional Derivatives Of Ascorbate Oxidase From Zucchini: Reduced-, Peroxide-, And Azide-Forms [Cucurbita pepo var. melopepo],1ASO_B X-Ray Structures And Mechanistic Implications Of Three Functional Derivatives Of Ascorbate Oxidase From Zucchini: Reduced-, Peroxide-, And Azide-Forms [Cucurbita pepo var. melopepo],1ASP_A X-ray Structures And Mechanistic Implications Of Three Functional Derivatives Of Ascorbate Oxidase From Zucchini: Reduced-, Peroxide-, And Azide-forms [Cucurbita pepo var. melopepo],1ASP_B X-ray Structures And Mechanistic Implications Of Three Functional Derivatives Of Ascorbate Oxidase From Zucchini: Reduced-, Peroxide-, And Azide-forms [Cucurbita pepo var. melopepo],1ASQ_A X-Ray Structures And Mechanistic Implications Of Three Functional Derivatives Of Ascorbate Oxidase From Zucchini: Reduced-, Peroxide-, And Azide-Forms [Cucurbita pepo var. melopepo],1ASQ_B X-Ray Structures And Mechanistic Implications Of Three Functional Derivatives Of Ascorbate Oxidase From Zucchini: Reduced-, Peroxide-, And Azide-Forms [Cucurbita pepo var. melopepo]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|W3X732|PFMAY_PESFW	7.48e-102	25	578	22	563	Laccase PFICI_06862 OS=Pestalotiopsis fici (strain W106-1 / CGMCC3.15140) OX=1229662 GN=PFICI_06862 PE=3 SV=1
sp|E9RBR0|ABR2_ASPFU	7.98e-95	28	583	22	577	Laccase abr2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=abr2 PE=1 SV=1
sp|A0A4Y6F0M8|USTL_USTVR	3.07e-88	12	583	9	599	Laccase ustL OS=Ustilaginoidea virens OX=1159556 GN=ustL PE=1 SV=1
sp|A0A1S7IUL2|MCE_TALPI	3.94e-86	27	585	25	588	Multicopper oxidase MCE OS=Talaromyces pinophilus OX=128442 GN=MCE PE=1 SV=1
sp|Q0UHZ8|ELCG_PHANO	9.17e-86	44	585	59	610	Multicopper oxidase elcG OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) OX=321614 GN=elcG PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000294	0.999678	CS pos: 23-24. Pr: 0.9770

TMHMM  Annotations     

There is no transmembrane helices in CAP83037:RNA-p1.